KEGG   Chloroflexus aggregans: Cagg_0399Help
Entry
Cagg_0399         CDS       T00824                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cag  Chloroflexus aggregans
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cagg_0399
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cagg_0399
   00680 Methane metabolism
    Cagg_0399
Enzymes [BR:cag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cagg_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
491405..494206
Genome map
AA seq 933 aa AA seqDB search
MSGRTTAGEHDLLSANIRTLGDMLGRVITEQSGAATFELVERVRLMAKELRNGAPPAGTH
VLQDLITGLSLPQLRNLVKAFTLYFGLVNLAEGVEQLRVLRSRDLRNAPAPRAESIADAI
ELLKRHGVPAAAIQEWIDQALIMPVFTAHPTESRRRTILIKLRRIFDTLIDLTFGERLVL
PSDRQSALTRIERETVGLWQTDDVRNRRPSVLDEVENGLFYFQTVLWDLIPEIYRETADA
LATAYPDHRWRLPPFLRFGSWMGGDRDGNPFVTPEVTVETVRLMRSAMLRYLINGIDRLI
TDLSQSVQQVPVDQAIFDRIAEYHELMPDAAATLNPHYRCEPYRQLCHFIQARLQNTLHY
TLSHTPRWGADPPPPRLPTIYYHSRELLADLDLIDTSLRRHGGAIIADGLLRDLRTNVAV
CRLHTATLDVRQHASRHTEALTEILAGAGVVANYAALDECERVAVLSTEIRRPRPLTPIR
LGHFSPATAETVQTFRMLAAISEQLDPEIFQTYIISTTSQVSDLLAVLLFCRDAGLYQPG
QYSRLDIVPLFETGEDLQRAPLILDELLQLPVYREHLALRDNLQEVMLGYSDSNKEGGFL
AANWALYRAQVELNTVTERHGVRLRFFHGRGGAVGRGGGPAGQAILAQPPGTLHGQIKVT
NQGEVISDRYLDPRTAHRHLEQVVNAVLRAGFPGIARSPEPAWLEAMEQMAHTARTVYRR
LVYEDPDFLTYFRNATPVAELSRLRIGSRPVSRRKSDRIEDLRAIPWVFSWMQTRHTLPG
WFGLGSALSEFVAADPHHLYVLRAMYRHWPFFTTLLDNAQMIMLKADMSIARSYAGLVPD
QELAARIFQQIEAEYRRTEHMICQITESQELLAHQPVLQRAIRQRNPYIDPLSYIQIELL
RRIRNAPPEDQDEIETVLLMSINGIAAGLKNTG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacgaactactgctggagaacacgatctgttgtcggcaaacattcgaacgctg
ggcgatatgctgggtcgggttatcaccgagcaaagcggcgccgcaacgtttgaactggtc
gaacgggtgcgcttgatggcaaaagaactacgcaacggcgctccaccagcgggtacgcac
gtgttgcaagacctcattaccgggctgagcttaccccaattgcgcaacctggtcaaagcg
tttaccctgtacttcgggttggtcaatctggccgaaggtgttgaacaattgcgtgtcctg
cgcagtcgcgacctccgtaatgcaccggcccctcgcgccgagagtattgcggacgcgatt
gagctgctgaaacgccacggagtaccggctgccgcgatccaagagtggatcgaccaggcc
ctgattatgccggtatttaccgctcaccctaccgaatcacgccgacgaaccatcctgatc
aaattacgccggatttttgatacgttgattgatttgacctttggtgaacggttggtcctt
ccatcggatcgccaatcggcactcactcgtatcgaacgcgaaacggttggtctgtggcag
accgacgatgtacgcaaccgccggccatcggtccttgatgaagtcgaaaacggtctgttc
tattttcaaactgtactctgggatttgatcccggagatttatcgcgaaactgccgatgca
ctggcgacagcataccccgaccaccgatggcgactaccaccgttcttgcgattcgggagc
tggatgggtggcgaccgtgatggtaatcctttcgtgacacccgaagtgacggttgaaacg
gtgcgcttgatgcgtagcgcgatgttacgctatctgatcaacggtattgatcgtttgatc
accgatctaagtcagtcggtacaacaggtaccggtcgatcaggccatatttgaccggatc
gccgaatatcacgagctgatgccagatgcggctgctacgcttaacccccactaccgctgc
gagccgtaccggcaattatgtcacttcattcaggcccggctccaaaacactctccattac
acacttagtcatacgccgcgctggggggccgatccaccaccgccacgcctaccaactatc
tactaccacagtcgcgaactcctcgccgatcttgatctgatcgataccagccttcgtcgt
cacggcggggctattattgccgacggtctgctgcgcgatctgcgtacaaacgtggccgta
tgccggctccacactgcaacccttgacgtgcgccaacacgcaagccgccataccgaagca
ctcaccgagatccttgccggcgccggcgtagtcgccaactatgctgcacttgatgaatgt
gagcgcgttgctgtgttgagcaccgagattcgccggccccgcccgcttactccgatccga
ctcggtcatttcagtccggctaccgccgagacggtacagacatttcggatgctggcagct
attagcgagcaactcgatccagaaatcttccagacctatatcatttcaaccaccagccag
gtgagcgatctgctggccgtcttgctcttttgccgcgatgccggtctgtaccaacccggc
cagtacagccggttggatattgtgccactgttcgagacaggcgaagatttgcaacgtgcg
ccattaatcctcgatgagctactccagttgccggtctaccgtgagcatctggctttgcgc
gataatctgcaagaggtgatgctcggttattccgatagtaacaaagagggtggttttttg
gctgccaattgggcactgtatcgcgcccaagtcgagttgaataccgtgaccgaacgccac
ggtgttcgcctccgcttcttccacgggcgtggtggcgcggttggtcgcggtggtggaccg
gcgggtcaggcaatcctcgctcaacctcccggtacgctccatggtcagattaaggtcacc
aatcagggtgaagtcatctccgatcgctatctcgatccgcgtaccgcccatcgccacctc
gaacaggtggtgaatgcagtattgcgcgccggcttccccggtatcgcccggtcacctgaa
ccggcttggctggaggcaatggaacagatggcgcacacggcgcgaaccgtgtatcgccgg
ttagtgtacgaagaccctgattttctgacctatttccgcaatgctacgccggtcgccgag
ctgagtcgcctgcggatcggctcacgtccggtctcacgccggaaaagtgaccggatcgaa
gacctccgcgctattccgtgggtctttagctggatgcaaacccgccataccctgccgggt
tggtttgggctggggagtgcgctgagcgagttcgtcgccgccgacccgcaccatctttac
gtgctgcgggcaatgtaccgacactggcccttcttcacgaccctgctcgataatgcgcag
atgatcatgctcaaagccgatatgagcatcgcacgcagttatgccggtcttgttcccgat
caggagttggcggcgcgtatttttcaacagatcgaagccgaatatcggcgtactgaacac
atgatctgccaaattaccgagagtcaagaattgctagcgcaccaaccggtgctgcaacga
gccattcgacagcgtaatccctatatcgatccgctcagctatattcagatcgagctgctc
cgccgaatccgtaacgcaccaccggaagatcaggatgaaatagagacggtactactgatg
tcgattaacggcattgcagccgggttgaagaacacaggctaa

DBGET integrated database retrieval system