KEGG   Chloroflexus aggregans: Cagg_2872Help
Entry
Cagg_2872         CDS       T00824                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cag  Chloroflexus aggregans
Pathway
cag00500  Starch and sucrose metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cagg_2872
Enzymes [BR:cag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cagg_2872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase TCL1_MTCP1
Motif
Other DBs
NCBI-ProteinID: ACL25734
JGI: Cagg2872
UniProt: B8G601
LinkDB All DBs
Position
3527134..3529284
Genome map
AA seq 716 aa AA seqDB search
MLRFEHEILFTPCPERIARLRELAYNLWWTWHPEAQDLYRSIDPELWELVYHNPVEFLRD
VRQRKLEAAANDPAYLKRYDAVLKSFDSYMRSEKTWFRKNYPDAKDTLIAYFSAEFGLHE
SLPIYSGGLGILSGDHIKEASDMGIPLVGVGFIYPQGYFRQRIDPSGWQHAEYNKLNFAD
VPALPALDPDGREVVIEVELPGRTIYAKVYKFQVGRVELLLMDTDIHPNSPQDRELSARL
YGGDQEMRISQELVLGVGGVRALRRLGYKPTVWHMNEGHSAFLVLELCRELVAQGYSFDE
AMEQVKAHCVFTTHTPVPAGNDAFPLPMIEKFFWSFWPQLNLTRDEFMNLALQEQQWGST
FAMTALALRFSAYRNGVSKLHGHVARGMWQWLYPGRSQDEVPITSITNGVHTATWLAPEM
RTLYTSYLGKNWEENLDDPHMWRKVYQIPDETFWRTHQKLKSDLIAFSRQRLQQHYIRLG
IPAPVWPVLEEDILTIGFARRFATYKRATLLFKDIERLKYILNRPGKPIQIIFAGKAHPK
DDPGKQFIQEVYRLSMQPGLAGRIVFLEEYDIAVGRALVQGVDVWLNNPRRPYEASGTSG
MKASLNGAPNCSVLDGWWPEAYNGRNGWAIGDEREYANQDEQDWNDAQSLYHLLEHEIAP
RFYDQRDANGIPVEWIQICKEAIATVAPIFSTRRMLAEYLREMYMPVAVQGAMPQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggtttgaacacgagattctgttcactccatgtcccgaacggattgctcggctt
cgtgaacttgcctacaacctttggtggacgtggcatcccgaagcgcaagacctttatcgt
tctatcgacccagagctgtgggagctggtgtatcacaacccagttgagttcttgcgcgat
gtacgtcagcgcaaacttgaggctgctgccaacgatccggcctatctgaagcggtacgat
gcggtactcaagagcttcgacagctacatgcggtctgaaaagacgtggttcagaaagaat
tatcccgatgcgaaagacacgttgatcgcatattttagtgccgagtttggcctccacgaa
agcctaccaatctactcaggcggtttgggcatcttgtcgggcgatcacatcaaagaggct
agcgatatgggcatcccactggtcggcgttggctttatctacccgcagggctacttccgg
caacgcatcgaccctagtggttggcagcacgccgagtacaacaagctcaattttgccgat
gtaccggcgctaccggcgctcgatcccgacggacgtgaggtggtgatcgaggtggaatta
cccggtcgcacgatctacgccaaggtctacaagtttcaagttggtcgggttgagctgttg
ttgatggataccgacatccacccgaacagtccacaagatcgcgaattatcggcgcggctc
tacggtggcgaccaagagatgcgtatttcgcaagagttggtgcttggtgtaggtggtgtg
cgggcgctgcgtcgtctcggttataaaccgacggtctggcatatgaatgaagggcactcc
gccttccttgtgctcgaactgtgtcgcgaattggtggcgcaggggtacagttttgacgag
gcgatggagcaggtcaaggcgcattgtgtgttcacgacccacaccccggtccccgccggt
aatgatgccttcccgctgccgatgatcgagaagttcttctggagtttctggccgcaactc
aacctcacccgcgatgagtttatgaatctggctttgcaagagcagcaatggggatcgacc
tttgcaatgacggcgctggcactgcgcttttcagcttatcgcaatggggtgagcaaattg
cacggtcatgtggcacgcggcatgtggcagtggctctatcccggtcgttcgcaagatgag
gtgccgattacctcgattaccaacggtgtgcatacggcaacgtggctggcgccggagatg
cgtacactctatacctcgtatttgggcaagaactgggaagaaaacctcgatgatccgcat
atgtggcggaaggtataccagattcccgatgagactttctggcggacccatcaaaaactg
aagagtgatctgatcgcgttcagtcgccagcgtctccaacagcactacatccgcttgggc
attccggcgccggtttggccggtgttggaagaggatattttgacgatcggctttgcccgt
cggtttgcgacctacaagcgggcgacattgctgtttaaagatattgagcgactgaaatac
atcttgaaccggcccggtaagccgattcagattatctttgccggaaaagcgcatcctaag
gatgatccgggcaaacagtttatccaagaggtctatcgtctctcgatgcagccggggctg
gccgggcggatagtgttcctcgaagaatacgatattgcggtggggcgagcactggtgcaa
ggtgtcgatgtctggctcaacaacccgcgtcgcccttacgaggcgagtggcacaagtggg
atgaaggccagtctcaacggtgcgcctaactgttcggtactcgatggctggtggccagaa
gcgtacaatgggcgcaacggttgggctatcggtgatgagcgtgagtatgcgaaccaagac
gagcaggactggaacgatgcgcaatcgctctaccatctgctcgaacacgagattgcaccc
cgcttctacgatcagcgcgatgccaatgggattccggtagagtggattcagatttgcaag
gaggcaattgcgacagtagcaccaatctttagcacgcgccggatgttggccgaatatctg
cgcgagatgtatatgccggtggcagtgcaaggtgcaatgccgcaagcctag

DBGET integrated database retrieval system