KEGG   Catenulispora acidiphila: Caci_3458Help
Entry
Caci_3458         CDS       T00967                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3832971..3839723
Genome map
AA seq 2250 aa AA seqDB search
MAEATFGDLLGRRAARQPDRVGYVFLGEDVSDASQETAITYAALDARARAVAAGLRRQGV
GVGDRALLLYAPGAEFLTAFFGCLYAGVVAVPTFPPDPFRLERTLPRLLATTVDADPVAA
LTTSDLLPLAGMLNEHAPRFGELRWIATDAADIAVADAADDFASPSLTGDSVALLQYTSG
STGTPKGVVLTHANLLHNVRQIQDFFAVTPDSRGLSWLPPYHDMGLIGGLLEPLFVGMPI
WLMAPFDFLKRPVSWLQALTRIGATASGGPNFAYDLCARKTTPEQLAALDLSSWSVAFNG
AEPIRRATLERFAERFGPAGFRASAFLPCYGLAEATLIVGGGSLASTAGAVERAALEVGE
VVAVAVDAKPGPDALVSCGPASVDQRIAIVDPDSLCRLPTDRVGEIWLSGPSVAAGYWGR
PEETAEVFRAKLVGDDTDWLRTGDLGFVRDGELVITGRLKDLIIIRGRNHYPQDLELSAE
QAHPSLRPGCSVAFLDDDDQLVVVTEAARGAALDPAEVASAVRTRIAEDHSVQVATVVLI
AAGEVPKTSSGKVRRRDCARMLAAGELQVLGQGALRAAAHLPATDAHISHLRALTAVVCD
VPESAVDPAASLLTLGLDSLAAIELQSRIESEFGATVPLERILAGATLVALAAELATGSA
TDHAPAPTVERGAELTPNERALWFLQRLDPDSTAHITAAAIRLTGPLDVAALRRAVAELV
HRHPALRSTFPLRDGEPVRVIHPDPAGVLTELATPANSLVSDAYHPFDLDEGPLLRVRLY
RHAPEEHVLLLSAHHLVTDFWSTTVLARELAALYTGASLPPAVQQPAPPVPSPTDADYWD
SQIGAPALRLTSHDPARAFAPAGTQRIHLAPADADRLRAMAAAQGVTLNVVLLTAFETLL
HLWTGQDDLAIGMPVAARTRPGSAQAVGYLMNPVPLRSTIADTDHATFAELLSQTRSRVI
GALEHQQYPIALLAERHAASRRGLFQAMYVFNRPTTPDAAGLPSALLGHPGIRRTLGPLT
VESLPLPAPQAASDLELALTEADTAIRGTLHFRTDAFDTPTATAFCAQYKALLQAAATTP
TTPLHTLLQAPTAPHWNTTDRTWHDPHLTVPQLFEAQARRTPDAIAVTTFSATTPPTVTS
PAAASPPAAALPAGASTALAAASAAITSAADASPAAALPPPTSAASASSAAAPPPAPTSA
LTYRDLDQQANRLAHLLRIGGAAPGRRIGILLDRSPLIPVALLAVLKSGAAYVPVDPANP
PGRIAAVFRDAGVEAVLTEPLLAAKVPSGVTAILLGASDSASALPATPPEPAPAPHDIAY
VIYTSGSSGPPKGVEIPHSALANHTRHAAEAYRTGPGDRVLQFASIAFDASAEEIYPALI
SGAQLVLRNDTMLASPKAFLDACAERAVTVLDLPTAFWHSLAAALADQTATLPADLRLVI
IGGEAARADRVAAWRETVGNRVRLVNTYGPTEATIVATAAELIAPESDTSQDANTGTVPI
GRPIANTRAHVLDAALRPVPIGVVGELHLAGAGLARGYLDRPALTAQRFVADPFGPPGSR
LYRTGDLARRLPDGSIAFAARADRQVKLNGYRVEPGEVEAALRRLPAVADAAVVPDVRPG
RLLAYVTPSPSPSRATDTAETPAPTPETLRTALRAELPEYMIPAAFVLLPEFPRTPGGKI
DYAALPTATALPAAPTAPAEPPRTPEERALAGIWSEALGLTEIHRHDDLFALGGHSLLAT
RILADVNDRMGRDVPLRAVFEAPTLAALAERIAQAPPSTAGAIPRAPRDQPIPLSFQQER
IWFLQQLEPDSTNYNVPRAMRLRGDVDPEAVRLALSDLEARHEILHTAFPDIDGVPVQSV
REPRGIPVTLLDRRDLPEHERESWLRATIVTAGAEPFDLADGQLIRVTLIRLADDEYVLF
MVEHHLVHDGWAQGVFLRDFLELYEARSVGREPRLPALAVQYADFAVWQRAALQGERLTA
LQDHWEQRLSGAPAVLRLPTDLPRPTVLGTSGDQESLEIDGELARRLRAFGQEHGVSLFM
TMFAAFLALLHGLSGQEDIVTGTGIANRRRPELDDQLGMIINTVLLRTDVSGDPTFADLL
ERVRETCLDAYTHQDMPFEKLVHRLRPARSLDHSPLFQVMYSFLDTPMPALRLPGVTAEV
LDAHNGSAKFELNCVVIPHAEQRFHDAEEVPDVETITVALEYNTDLFQAATIRRWLDHYA
ALLDAATADPSRSVAALAERAGVADSRPIG
NT seq 6753 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaggcgacgttcggggacctgctggggcgccgggcggcgcgccagcctgatcgg
gtggggtacgtcttcctgggggaggacgtgtcggatgcttcgcaggaaactgcgatcacc
tacgccgccctcgacgctcgcgcgcgcgccgtggctgccgggctgcgccggcagggcgtc
ggcgtcggggatcgcgcgctgttgctgtacgcgccgggagcggagttcctgactgcgttc
ttcggctgtctgtacgccggcgtcgtcgccgtgccgacgttcccgccggacccgttccgg
ttggagcggacgttgccgcgcctgctggcgacgaccgtcgatgcggatccggtcgctgcg
ctgaccacctctgatcttctgccgctggccgggatgttgaacgagcacgcgcctcggttc
ggagagctgcgttggatcgctaccgacgccgccgacatcgctgttgccgacgcagccgat
gacttcgcttcaccgtcgctcaccggcgactcggtcgcgttgttgcagtacacgtcgggt
tcgacgggcactcccaagggagtcgtcctcacccacgcgaacctcctgcataacgtccgc
cagatccaggacttcttcgccgtcactcccgactcgcggggtctgagctggctgccgccg
taccacgacatggggctgatcggcgggctgctggagccgctgttcgtcgggatgccgatc
tggctgatggcgccgttcgacttcttgaagcgcccggtcagctggctccaagccctgacg
cgcatcggcgccaccgcgagcggcggaccgaacttcgcctacgacctgtgtgcgcgcaag
accacccccgagcagctcgcggcgctggacctgagcagctggtcggtggcgttcaacggc
gccgagccgatccgccgcgccacgctggagcgcttcgccgagcggttcggacccgccggg
ttccgggcgtcggcgttcctgccctgctacgggttggccgaggcgacgctgatcgtcggc
ggcggttcgctggcttcgacggccggcgcggtggagcgtgcggcgttggaggtgggggag
gtggttgcggtcgctgtggacgcgaagcccggtcccgacgctttggtgagttgcggacct
gcctcggtggatcagcggattgcgatagtcgacccggacagcctgtgccgactgcccact
gaccgagtcggcgagatatggctctccggaccgagcgtcgcagccgggtattggggacgt
cctgaggagaccgccgaggtcttccgcgcgaagctcgttggcgacgacacggactggctg
cggaccggcgacctagggttcgtccgcgacggcgagctggtcatcaccggacgtctcaaa
gacctgattatcatccgcggacgcaaccactacccccaggacctggagctttccgccgag
caagcgcatccctcgctgcgaccgggatgcagtgtcgctttcctggacgacgacgatcag
ctggtcgtcgttaccgaggcggcgcgtggagctgccttggaccctgcggaggtcgcgagc
gccgtgcgcacccggatcgccgaggaccactcggtgcaggtcgcgacggtcgtcctgatc
gcggcgggggaggtgcccaagacgtcgagcgggaaggtacggcgccgagactgtgcgcgc
atgctcgcggcgggggagttgcaggtactcggacagggcgcgctacgcgccgctgcgcat
ctgccagccacggacgcacacatctctcacctccgtgctctcacagcagtggtctgcgat
gtgcccgaatcagccgtggatcccgcggcgtcgttgctcacgctcggtctggactcacta
gccgccatcgagctccagtctcggatcgagtccgagttcggcgcgacggtaccgctcgaa
cgcattctggccggcgccacgctcgtcgcactagccgccgaacttgccaccggttctgcg
accgatcacgcccccgcccccacggtcgaacgcggcgccgagctaactcccaacgagcgt
gcgctgtggttcctccaacgcctcgaccccgactcgaccgcgcacatcaccgccgccgcc
attcgactcaccgggccgctcgacgttgccgccctgcgccgtgccgtggccgaactcgta
caccgccatcccgccctacgtagcacgttcccgctgcgcgacggcgaaccagtacgagtg
atccacccagatcccgctggcgtcctcactgaactggctactcccgccaactccctcgtc
tcggacgcctaccaccccttcgacctcgacgaaggtccgctcctccgagtccgcctctac
cgccacgcgcccgaggaacatgtgctcctcctctccgctcaccatctcgtcaccgacttc
tggtccacgaccgtcctcgcccgcgaactagccgcgctctacaccggcgcgtccctacct
cctgcggtgcagcagcctgcgccacctgtcccatcgccgactgacgccgactactgggac
tcccagatcggcgccccggcactacgcctgacgtcccacgatccagcgcgcgccttcgcc
cctgccgggacgcagcggatccacctcgcccccgctgacgcagaccggctacgtgccatg
gcggccgctcagggcgtgacgttgaacgtcgtcctgctcaccgctttcgagacgctgcta
cacctctggaccggtcaggatgatctcgccatcggcatgccggtcgccgcacgcacccgt
cccggctccgcacaggcagtcggctatctcatgaacccggttcccctacgcagcacgatc
gccgacacggaccacgccacgttcgccgaactcctgtcccaaactcgatcgcgagtcatc
ggcgcgctagagcaccagcagtacccaatcgccctactcgccgaacgccacgcagcctcc
cgccgcggcctgttccaggcgatgtacgtcttcaaccgcccgaccacccccgacgccgcc
ggcctcccctcggcactactcggccaccccggcatacgccgcacactcggcccactgacc
gtcgagtcactgcccctacccgcaccccaagccgcatccgacctcgaactcgccctcacc
gaagccgacaccgcaatccgcggcaccctccacttccgcaccgacgccttcgacaccccc
accgccaccgccttctgcgcccaatacaaggccctcctccaagccgccgccaccaccccc
accacccccctgcacaccctcctccaagcccccaccgccccccactggaacaccaccgac
cgcacctggcacgacccgcacctcaccgtgccgcaactcttcgaggcccaagcccgccgc
acccccgacgccatcgcggtcacaaccttcagcgccaccaccccgccaacagtcacgtca
cccgcagccgcctcgccgcccgccgcagccttgcccgccggtgcctcgaccgcgctcgcc
gctgcttcggccgcaatcacgtcagccgcagatgcctcgccagccgctgccctgccgccc
ccgacctccgctgcttcggcctcgtctgccgccgcgcccccgcccgccccgacgtctgcc
ctcacctaccgcgacctcgaccaacaagccaaccgcctagcccacctcctccgcatcggc
ggtgccgcccccggccgccgtatcggcatccttctcgaccgcagtcctctgattccggtc
gcgctgctcgcggtcctgaagtccggcgccgcctacgttcccgtcgatccggccaacccg
cccggtcgcatcgccgccgtcttccgcgatgccggcgtcgaggccgtgctcaccgagccg
ctgctcgctgcgaaggtgccgtcgggcgttaccgcgatcctgctcggcgcctccgattcg
gcctccgccttgcccgcgacgccgccggagcccgctcccgcgccgcacgacatcgcctac
gtcatctacacctccggctccagcggaccgccgaagggcgtcgagatcccgcacagcgcg
ctggcgaaccacacccgccacgccgccgaggcctaccgcaccggtcctggcgaccgcgtg
cttcagttcgcctcgatcgccttcgacgccagcgccgaggagatctacccagccctgatc
agcggcgcacagctggtcctgcgcaacgacaccatgctcgcctcgcccaaggcgttcctc
gacgcgtgcgccgagcgcgcggtcaccgtcctcgacctgcccaccgcgttctggcacagc
cttgccgccgccctcgccgatcagaccgcgaccctgcccgccgacctgcgcctggtcatc
atcggcggcgaggcggcacgcgcggaccgggtcgcggcgtggagggagacggtcggaaat
cgggtccggctggtcaacacgtacggacccaccgaggcgaccatcgtcgccaccgccgcc
gaactgatcgcgccagagagcgacacatcgcaggatgcgaatacaggcaccgtccccata
ggccgccccatagccaacacccgagcccacgtcctcgacgccgccctccgccccgtcccc
atcggcgtcgtcggcgagctgcacctggccggtgccggcctcgcccgcggctacctcgac
cgccccgcgctcaccgcgcagcgcttcgtcgccgaccccttcggcccgcccggctcccgc
ctctaccgcaccggcgacctggcccgccgcctccccgacggctccatagccttcgccgcg
cgcgccgaccgccaggtcaaactcaacggctaccgcgtcgagcccggcgaggtcgaagcc
gcgctgcgccgcctgcccgccgtcgccgacgccgccgtcgtgccggacgtccgcccggga
cgcctgctcgcctacgtgactccgagtccgagtccgagccgagctacagacaccgccgaa
accccagcccccaccccagaaaccctccgcaccgccctccgcgccgagctccccgagtac
atgatcccggcagccttcgtcctcctccccgaattcccccgcacccccggcggcaaaatt
gactacgccgccctccccaccgccaccgccctccccgcagcgccgaccgcccccgccgaa
ccgccccgcacccccgaagaacgcgccctcgccgggatctggtccgaagcgctcggcctc
accgagatccaccgccatgacgacctgttcgccctcggcggccactccctcctggccacc
cgcatcctcgccgacgtcaacgaccgcatgggccgcgacgtccccctccgcgccgttttc
gaagcgcccaccctcgccgccctcgccgagcgcatcgcccaggctccgccgtccaccgcc
ggcgcgatcccccgcgccccgcgcgaccagccgatcccgctgtccttccaacaagagcgc
atctggttcctgcaacaactcgaacccgacagcaccaactacaacgtgccgcgcgccatg
cgcctgcggggcgacgtcgaccccgaagccgtccgcctcgcgctgtccgacctggaagcc
cggcacgaaattctgcacaccgccttccccgacatcgacggcgtccccgtccagagcgtc
cgcgagccgcgcggcatccccgtcaccctcctggaccgccgcgacctgcccgaacacgag
cgcgaaagctggctgcgcgccaccatcgtcaccgccggcgccgagcccttcgacctcgcc
gacggccagctgatccgtgtcaccctcatccgcctcgccgacgacgaatacgtgctcttc
atggtcgagcaccacctggtccacgacggctgggcgcaaggcgtgttcctgcgcgacttc
ctggagctgtacgaagcgcgctccgtcggacgcgaaccccgcctgcccgccctcgccgtc
cagtacgccgacttcgcagtctggcaacgcgccgcacttcagggcgagcgcctcaccgcc
ctccaagaccactgggagcagcggctgtccggcgcccccgccgtgctgcgcctgcctacc
gacctgccgcgccccaccgtgctcgggacctccggcgaccaggagagcctggagatcgac
ggcgagttggcgcgccgcttgcgcgccttcggccaggaacacggcgtcagcctgttcatg
accatgttcgcggccttcctcgccctcctgcacggcctgtccggccaggaggacatcgtc
accgggaccggcatcgccaaccgccgccgccccgaactcgacgaccagctcggcatgatc
atcaacaccgtgctgctgcgcaccgacgtgtccggcgatccgacgttcgccgacctgctc
gagcgggtccgcgagacctgcctggacgcctacacccaccaggacatgccgttcgagaag
ctggtgcaccgcctgcgcccggcgcgcagcctggaccactcgccgctgttccaggtgatg
tacagcttcctggacacccccatgcccgcgctgcgcctgcccggcgtcaccgccgaggtg
ctggacgcgcacaacggctcggcgaagttcgagctgaactgcgtcgtcatcccgcacgcc
gagcagcgcttccacgacgccgaggaggtcccggacgtcgagaccatcaccgtcgccctg
gagtacaacaccgacctgttccaggccgcgacgatccggcgctggctcgaccactacgcc
gcgctgctggacgcggccaccgccgacccctcgcgctcggtcgcggcgctcgccgagcgg
gccggggtcgcggacagtcgcccgatcgggtga

DBGET integrated database retrieval system