KEGG   Catenulispora acidiphila: Caci_3511Help
Entry
Caci_3511         CDS       T00967                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
cai  Catenulispora acidiphila
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cai00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Caci_3511
Enzymes [BR:cai01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Caci_3511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3915888..3917171)
Genome map
AA seq 427 aa AA seqDB search
MQDVATSSRTAETTATATAPTSRAECAALDAADPLAALRDEFVLPEGVVYFDGNSLGALP
RRTMAGVTRMIEQEWGQGLIRSWNGADWYPMPHTIGERVAPLIGAAAGQTVICDSVSVNI
FKVLISALRMRPTRGTLVSELDIFPTDLYITEGVRRLVPDSQMRLIGRDGPDLESVLGPD
TAAVLLSHVDYRTGRLHDMAAVTDLVHRHGALMIWDLCHSAGAMPIELDACGVDFAVGCT
YKYLNAGPGAPAFLYAAERHQDSVDQPLLGWSGHADPFAFEPGYTPVPGVGRFLAGTPPM
LSFAGLLAALEVFEDVDLHQVRAKSLALAELVIARGDELGLDLATPREPERRGSHVTFRH
EHGYQIVQALIEQGIIGDFRAPDHMRFGLTPLYTSFSEVWDAMDAMAEILATKSWQDERF
LRQGTVT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggatgtcgcgacctcttccaggaccgccgagaccaccgccacagccaccgcgccg
acaagccgcgccgaatgcgccgccctcgacgccgcggaccccctcgccgcgctccgcgac
gagttcgtcctgccggaaggcgtcgtctacttcgacggcaactccctcggcgcactcccc
cgccgcaccatggccggcgtcacgcggatgatcgagcaggagtggggacagggcctgatc
cgcagctggaacggcgcggactggtacccgatgccgcacaccatcggcgagcgcgtggcg
ccgctcatcggcgccgccgccgggcagaccgtgatctgcgactcggtgtccgtcaacatc
ttcaaggtgctgatcagcgccctgcgaatgcggccgacccgcgggaccctggtgtccgag
ctcgacatcttcccgaccgatctctacatcaccgagggcgtgcgccggctggtccccgac
agccagatgcggctgatcgggcgggacggcccggacctggagtccgtcctgggcccggac
accgccgccgtgctgctctcgcatgtcgactaccgcaccggacgcctgcacgacatggcc
gccgtcaccgacctcgtgcaccggcacggcgccctgatgatctgggacctgtgccactcg
gccggcgcgatgccgatcgagctcgacgcgtgcggcgtggacttcgccgtcggctgcacg
tacaagtatctgaacgccggacccggcgccccggcgtttctctacgccgccgagcggcat
caggactctgtcgaccaaccgctgctcggctggtcggggcacgccgatcccttcgccttc
gagcccggatacaccccggtgcccggcgtgggccgcttcctggccggaaccccgccgatg
ctcagcttcgccgggctcctggccgccctcgaagtgttcgaggacgtcgacctgcaccag
gtgcgcgccaagagcctcgcgctggccgagttggtcatcgcgcgcggcgacgaactgggt
ctggacctggcgacgccgcgcgagcccgagcggcgcggcagccatgtcaccttccggcac
gagcacggctaccagatcgtgcaggcgctgatcgagcagggcatcatcggggacttccgt
gccccggaccacatgcgcttcgggctcacgccgctctacacgagcttctccgaagtctgg
gacgccatggacgcgatggctgagatcctcgccacaaaatcttggcaagacgagcgattc
ctgcgccagggaaccgtcacctga

DBGET integrated database retrieval system