KEGG   Catenulispora acidiphila: Caci_3772Help
Entry
Caci_3772         CDS       T00967                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ACU72674
JGI: Caci_3772
UniProt: C7QD81
LinkDB All DBs
Position
complement(4260746..4262062)
Genome map
AA seq 438 aa AA seqDB search
MTATTGPTAFRARKLLMLSWEYPPVLVGGLGRHVHALATTLARAGHDVTVATRHAPGAPL
EEVVDGVRVVRAPQDPPVIPLDTEHLLAWAVAFNHTLTRTALHAARGQDFELVHAHDWLV
AHAAVTVKDHLGIPLVATIHATEAGRHQGWLPGDLNRGIHSIECWLAQESERVLVCSQYM
RREVSVLLGVPASKIDAIPNGVDMPRWRAEPKQVGLARAKYADSGPLVGFAGRLVHEKGV
QHLLHALPELRRTHPGLRAVICGDGPNRGELEQLTRRLGLEHAVSFGGFLGSRLSATMAA
TDAMVVPSLYEPFGMVALEAAAAGAPLAVSATGGLAEIVEPGVTGMTFPARDEGALARSV
SALLADRPSARRMVVTAKAMVRSRYGWPTVGEQTAAAYAAAVNDAPAVPAGPEELWRSRQ
HPITIPEGNLLASAGLAA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgacgaccgggccgacagcgttccgcgcaaggaagctcctcatgctctcctgg
gagtacccgccggtcttggtcggcgggctcggccggcacgtccacgcgctggccaccacc
ctggcccgggcggggcacgacgtgaccgtcgcgacccgccacgccccgggcgcgccgctg
gaggaggtcgtcgacggagtgcgcgtggtgcgcgccccgcaggacccgccggtcatcccg
ctggacaccgagcatctgctggcctgggccgtcgcgttcaaccacaccttgacccgcacc
gccctgcacgccgcccgcgggcaggacttcgaactcgtccacgcccacgactggctggtc
gcccacgccgccgtcaccgtcaaggaccatttgggcatcccgctggtggccaccatccac
gccaccgaggccggccggcaccagggctggctgcccggcgacctgaaccgcggcatccac
tccatcgagtgctggctggcccaggagtccgaacgcgtgctggtctgctcgcagtacatg
cgccgggaggtctcggtactgctcggtgtgccggcgtcgaagatcgacgccatccccaac
ggagtggacatgccgcgctggcgggccgagccgaagcaggtggggctggcgcgcgcgaag
tatgccgacagcggcccgctggtgggcttcgccgggcgcctggtccacgagaagggagtg
cagcacctgctgcacgcgctgcccgagctgcgccgcacccacccgggactgcgggcggtc
atctgcggcgacggtccgaaccgcggcgagctggagcaactcacccggcgcctggggctg
gagcacgcggtcagcttcggcggattcctgggctcccggctgtcggccacgatggccgcc
accgacgcgatggtcgtgccgagcctgtacgagcccttcggcatggtggccctggaagcc
gccgcggccggcgccccgctggccgtctcggcgaccggcggcctggccgagatcgtcgag
cccggcgtcaccggcatgacgttcccggcgcgcgacgagggcgcgctggcgcggtcggtg
tccgcgctgctggcggaccggccgtccgcacgccggatggtggtcaccgccaaggcgatg
gtccgcagccgctacggctggcccaccgtgggcgaacagaccgcggccgcctacgcggcg
gccgtcaacgacgcgccggctgtgcccgccgggcccgaggaactatggcggtcccggcag
catccgatcaccatcccggagggcaacctgctcgcgtcggcgggactggcggcttga

DBGET integrated database retrieval system