KEGG   Catenulispora acidiphila: Caci_3772Help
Entry
Caci_3772         CDS       T00967                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4260746..4262062)
Genome map
AA seq 438 aa AA seqDB search
MTATTGPTAFRARKLLMLSWEYPPVLVGGLGRHVHALATTLARAGHDVTVATRHAPGAPL
EEVVDGVRVVRAPQDPPVIPLDTEHLLAWAVAFNHTLTRTALHAARGQDFELVHAHDWLV
AHAAVTVKDHLGIPLVATIHATEAGRHQGWLPGDLNRGIHSIECWLAQESERVLVCSQYM
RREVSVLLGVPASKIDAIPNGVDMPRWRAEPKQVGLARAKYADSGPLVGFAGRLVHEKGV
QHLLHALPELRRTHPGLRAVICGDGPNRGELEQLTRRLGLEHAVSFGGFLGSRLSATMAA
TDAMVVPSLYEPFGMVALEAAAAGAPLAVSATGGLAEIVEPGVTGMTFPARDEGALARSV
SALLADRPSARRMVVTAKAMVRSRYGWPTVGEQTAAAYAAAVNDAPAVPAGPEELWRSRQ
HPITIPEGNLLASAGLAA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgacgaccgggccgacagcgttccgcgcaaggaagctcctcatgctctcctgg
gagtacccgccggtcttggtcggcgggctcggccggcacgtccacgcgctggccaccacc
ctggcccgggcggggcacgacgtgaccgtcgcgacccgccacgccccgggcgcgccgctg
gaggaggtcgtcgacggagtgcgcgtggtgcgcgccccgcaggacccgccggtcatcccg
ctggacaccgagcatctgctggcctgggccgtcgcgttcaaccacaccttgacccgcacc
gccctgcacgccgcccgcgggcaggacttcgaactcgtccacgcccacgactggctggtc
gcccacgccgccgtcaccgtcaaggaccatttgggcatcccgctggtggccaccatccac
gccaccgaggccggccggcaccagggctggctgcccggcgacctgaaccgcggcatccac
tccatcgagtgctggctggcccaggagtccgaacgcgtgctggtctgctcgcagtacatg
cgccgggaggtctcggtactgctcggtgtgccggcgtcgaagatcgacgccatccccaac
ggagtggacatgccgcgctggcgggccgagccgaagcaggtggggctggcgcgcgcgaag
tatgccgacagcggcccgctggtgggcttcgccgggcgcctggtccacgagaagggagtg
cagcacctgctgcacgcgctgcccgagctgcgccgcacccacccgggactgcgggcggtc
atctgcggcgacggtccgaaccgcggcgagctggagcaactcacccggcgcctggggctg
gagcacgcggtcagcttcggcggattcctgggctcccggctgtcggccacgatggccgcc
accgacgcgatggtcgtgccgagcctgtacgagcccttcggcatggtggccctggaagcc
gccgcggccggcgccccgctggccgtctcggcgaccggcggcctggccgagatcgtcgag
cccggcgtcaccggcatgacgttcccggcgcgcgacgagggcgcgctggcgcggtcggtg
tccgcgctgctggcggaccggccgtccgcacgccggatggtggtcaccgccaaggcgatg
gtccgcagccgctacggctggcccaccgtgggcgaacagaccgcggccgcctacgcggcg
gccgtcaacgacgcgccggctgtgcccgccgggcccgaggaactatggcggtcccggcag
catccgatcaccatcccggagggcaacctgctcgcgtcggcgggactggcggcttga

DBGET integrated database retrieval system