KEGG   Catenulispora acidiphila: Caci_7300Help
Entry
Caci_7300         CDS       T00967                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: ACU76129
JGI: Caci_7300
UniProt: C7Q8E1
LinkDB All DBs
Position
complement(8480384..8481814)
Genome map
AA seq 476 aa AA seqDB search
MSVLTFTDQYIGGKWIPSAATETVDVLNPATEEVIAVIPAGGAADVDAAVAAARSAARAW
GASHKDYRLEFLGHLVAKLAEAQPEIVETVVAELGCPVGFATAVQAALPLGVAESYLRIL
ADYEFEEQVGNSTVYHEPAGVVGAITPWNYPLHQVVAKVVPALAAGCAVVLKPAEDTPLT
ARLFARLVDEAGFPPGVFNLVTGTGAAAGAALAAHPDVDMVSFTGSTAVGRQVAEHAGRG
VKRLALELGGKSACVVLPGADLAKAVNVAVANVFNNSGQTCSAWTRLLVPEDHYAEALSI
AADAAAKFVPGDPTKAETRVGPLVNAKQRERVRGYLNDAVGEGARVVVGGAQPPEGLPTG
FYVRPTVLADVTTDMAVAREEIFGPVISVMSFHDAEDALRIANATEYGLAGAVWAADDHE
AVAFARRMDTGQVDINGGRFNLAAPFGGYKGSGVGRELGRFGLEEYLQTKSLQFRV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgctcaccttcaccgaccagtacatcggcggaaaatggatcccctcggcggcc
accgagacggtggacgtgctgaacccggccaccgaagaggtgatcgccgtcatcccggcc
ggcggggcggccgacgtggacgccgccgtggccgcggcccggtcggcggcgcgcgcctgg
ggcgccagccacaaggactaccgcctggagttcctcgggcatctggtcgccaagctcgcc
gaggcgcagccggagatcgtcgagaccgtcgtcgccgagctcggctgcccggtcggcttc
gccaccgccgtgcaggccgcgctgccgctgggtgtcgcagagagctacctgcgcatcctg
gccgactacgagttcgaagagcaggtcggcaactcgaccgtctaccacgagccggccggc
gtcgtcggcgcgatcacgccgtggaactacccgctgcaccaggtcgtcgccaaggtggtg
ccggcgctggcggccgggtgcgccgtggtgctcaagcccgccgaggacacgccgctgacc
gcgcgcctgttcgcccggctggtcgacgaggccggcttcccgcccggcgtgttcaacctg
gtcaccgggaccggggcggcggccggcgccgcgctggccgcgcacccggacgtcgacatg
gtctccttcaccggctccaccgccgtcggccggcaggtcgccgagcacgccgggcgcggc
gtcaagcggctcgcgctggaactcggcggcaagtcggcgtgtgtcgtgctgcccggcgcg
gacctggcgaaggcggtcaacgtcgcggtcgccaacgtcttcaacaactccggccagacc
tgctcggcctggacccgcctgctggtcccggaggaccactacgccgaggcgctgagcatc
gccgccgacgccgcggccaagttcgtgcccggcgacccgaccaaggccgagacccgggtc
ggcccgctggtcaacgccaagcagcgggagcgcgtgcgcggctacctgaacgacgccgtc
ggcgagggcgcgcgcgtggtggtcggcggcgcgcagccgccggagggcctgccgaccggc
ttctacgtccgcccgacggtcctggccgacgtcaccaccgacatggccgtggcgcgcgag
gagatcttcggcccggtcatctccgtgatgtccttccacgacgccgaggacgccctgcgc
atcgccaacgccaccgagtacggcctggccggcgcggtgtgggcggccgacgaccacgag
gccgtcgccttcgcccggcgcatggacaccggccaggtcgacatcaacggcggccggttc
aacctcgcggcgcccttcggcggctacaagggctccggtgtcggacgcgagctgggccgt
ttcgggctggaggagtatctgcagacgaagtcgctccagttccgggtctga

DBGET integrated database retrieval system