KEGG   Caulobacter sp. K31: Caul_0995Help
Entry
Caul_0995         CDS       T00651                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cak  Caulobacter sp. K31
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cak00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Caul_0995
Enzymes [BR:cak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Caul_0995
Transporters [BR:cak02000]
 Other Transporters
  Pores ion channels [TC:1]
   Caul_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1052639..1053280)
Genome map
AA seq 213 aa AA seqDB search
MSDELVFYTNPMSRGRIVRWMLEEVGVPYRTVVLDYASSMKAPEYLAVNPMGKVPAITHR
GVTVTEGAAICAYLADAFPEAGLAPDVRSPERGTYYRWLMFACGPVEAAVTNKSMGFEVP
ADRKAMAGYGCLEDTLAALEGAVTGRQYLVGDRFSAADVYVGAQIGWGMMFGSIEKRPAF
ETYWAGISARPAAKRASEIDDALIAAAKEAAPA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgaactcgttttctacaccaacccgatgtcgcgcggccggatcgttcgctgg
atgctcgaggaagtcggcgttccctaccgcacggtggtgctcgactacgcctcgtccatg
aaggctcccgagtacctggccgtcaatccgatgggcaaggtgccggcgatcacccatcgc
ggcgtgacggtcaccgagggcgcggcgatctgcgcctatctggccgacgccttccccgag
gccggcctggcccccgacgtccgctcgcccgagcgcggcacctattaccgctggctgatg
ttcgcctgcggcccggtcgaggcggcggtgaccaacaagtcgatgggcttcgaagtgccg
gccgaccgcaaggccatggccggctatggctgcctggaggacaccctggcggccctggag
ggcgcggtgaccgggcgccagtacctggtcggcgacaggttctcggcggccgacgtctat
gtcggcgcccagatcggctggggcatgatgttcggctccatcgagaagcggccggccttc
gagacttactgggccgggatcagcgcccgtccggcggccaagcgggcctccgagatcgac
gacgcgctgatcgcggcggcgaaggaagccgcgccggcttag

DBGET integrated database retrieval system