KEGG   Caulobacter sp. K31: Caul_2951Help
Entry
Caul_2951         CDS       T00651                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
cak  Caulobacter sp. K31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3201864..3203597
Genome map
AA seq 577 aa AA seqDB search
MNPPGQDTQPPATLVAGMLAAAAAYPENGFTFQDAAGRETFYSFPDLLLATERAAAGLQS
LGLGHGDRIALLTQDPEEFIIAFLGAVRAGIAPAPLYPPPPLGGIEIYLSQTVALLDVAR
PAALIGSAKVLGDIQAAVAGLDGVKAVATVQEIRACQAPMTPCEVGPDDVVFLQFTSGST
STPRGVIVTHRALVANIACFMDQSLQADPARDKGVTWLPLYHDMGLIGFVLGPVHTGVSV
VFMPTVRFAKSPAAWLDALHQHRGTITFAPNFAFALLLRRLRAEDLGRWDLSCVKALGCG
AEPIHPDLIERFLDVFAAAGLSRDAFLPAYGLAEATLAVALRRLGAPVSTQRVDRETFER
TGVSTPAREDRSWLDHVGFGGPFAGHEIAIRDPDGAALPHGREGDIWLHGPSVCAGYLGD
EAGWNAICRDGWLNTGDRGYLADGELFVSGRSKELIIVNGRNIHPQPLEWAVSALSGVRP
QCVAAFAVPSLTTEAIVIALEAKGRPTTDLVAAVEDAVEDLVACRPLDVVLLPSGSLSRT
TSGKLKRGHVRRRYLDGDLPRLEPTPVSMPVGEAGQP
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgccgggccaggacacgcaaccgccggccaccttggtcgcgggcatgctggcg
gccgccgccgcctatccggagaacggtttcaccttccaggacgcggcgggccgcgagacc
ttctacagcttccccgacctgctgctggccaccgagcgcgccgccgcgggcctgcaaagc
ctgggcctgggccacggcgaccggatcgccctgctgacccaggatcccgaggagttcatc
atcgcgttcctcggggcggtgcgggccgggatcgcgcccgccccgctctatccgccgccg
ccgctgggcggcatagagatctatctgagccagaccgtcgccctgctcgatgtggcgcgc
cccgccgccctgatcggctcggccaaggtgctgggcgacatccaggccgccgtcgccggc
ctggacggcgtcaaggccgtcgccaccgtgcaggagatccgcgcctgccaggcgccgatg
acgccctgcgaggtcggcccggacgacgtggtcttcctgcagttcacctcgggctcgacc
agcacgccgcgcggcgtgatcgtcacccaccgcgccctggtcgccaatatcgcctgcttc
atggaccagtcgctgcaagccgatccggcccgcgacaagggcgtcacctggctgccgctc
tatcacgacatggggctgatcggcttcgtgctgggacccgtccatactggcgtctcggtg
gtgttcatgccgaccgtgcggttcgccaagtcgccggccgcctggctggacgccctgcac
cagcatcgcggcaccatcaccttcgcccccaacttcgccttcgccctgctgctgcgccgg
ctgcgggccgaggatctggggcgctgggacctgtcctgcgtcaaggccctgggctgcggg
gccgagccgatccaccccgacctgatcgagcgcttcctcgacgtcttcgccgccgccggg
ctgagccgcgacgccttcctgcccgcctacggcctggccgaggccaccctggccgtggcc
ctgcgccggctgggcgcgccggtcagcacccagcgggttgaccgcgagaccttcgagcgc
accggcgtctccacgcccgcgcgggaagaccgttcctggctcgatcatgtcgggttcggc
ggccccttcgcgggacatgaaatcgctatccgcgaccccgacggcgcggccctgccccat
ggccgcgaaggcgacatctggctgcacggcccctcggtctgcgccggctatctgggcgac
gaggccggctggaacgctatctgccgggacgggtggctcaacaccggcgaccggggctat
ctggcggacggcgagctgttcgtgtccggacggtccaaggaactgatcatcgtcaacggc
cgcaacatccatccccagccgttggaatgggcggtcagcgcgctgtcgggcgtgcggcct
caatgcgtcgcggccttcgccgtgccgtccctgaccaccgaggccatcgtcatcgccctg
gaagccaagggccggccgacgaccgatctggtggccgccgtcgaggacgcggtcgaggac
ctggtcgcctgccggccgctcgacgtcgtcctgctgccgtccggctcgctgtcgcgcacc
acctccggcaagctcaagcgcggccacgtgcggcggcggtatctggacggcgacctgccc
agattggagccgacgcccgtctccatgcccgttggggaggcaggccaaccgtga

DBGET integrated database retrieval system