KEGG   Caulobacter sp. K31: Caul_3335Help
Entry
Caul_3335         CDS       T00651                                 

Definition
(GenBank) Glutathione S-transferase domain
Organism
cak  Caulobacter sp. K31
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3613264..3613881)
Genome map
AA seq 205 aa AA seqDB search
MKLYDSRRAPNPRRVRWFMAEKGIGDIEIVDVSIFDGEHKTPRFLAKAGLPNLPALEMDN
GQTITESVAICRYLESLYPAPNLFGGEACEAAVVEMWMRRTEMMVATPLMMMVRHSHPAM
ATIETQIPEVAASNRATAEKGLEMLDRRLADSAFIACDRLTMADILAATGIDFARMARFR
PDAELVNVQRWLADMMARPAAKAGV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacgacagccgccgcgcccccaatccccgccgcgtgcgctggttcatggcc
gagaaggggatcggggacatcgagatcgtcgatgtcagcatcttcgacggcgagcacaag
acgccgcggttcctggccaaggctggcctgcccaacctgccggccctggaaatggacaac
ggccagacgatcaccgagtcggtggccatctgccgttatctggaaagcctctatcccgcg
ccaaacctgttcggcggcgaggcctgtgaggccgcggtggtcgagatgtggatgcggcgg
accgagatgatggtcgccaccccgctgatgatgatggtgcgccacagccacccggccatg
gccacgatcgagacccagatccccgaggtcgccgccagcaaccgggccaccgccgaaaag
gggctggagatgctcgaccgccgcctggccgacagcgcgttcatcgcttgcgaccggctg
acgatggccgacatcctggcggcgacgggcatcgacttcgcccggatggcgcggttccgg
cccgatgcggagctggtgaatgtccagcgctggctggcggacatgatggcgcgaccggcg
gcgaaggcgggggtgtag

DBGET integrated database retrieval system