KEGG   Candida albicans: CAALFM_C307000WAHelp
Entry
CAALFM_C307000WA  CDS       T00189                                 

Gene name
RPD31, CaO19.6801
Definition
(RefSeq) histone deacetylase
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cal  Candida albicans
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cal00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CAALFM_C307000WA (RPD31)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CAALFM_C307000WA (RPD31)
Chromosome [BR:cal03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CAALFM_C307000WA (RPD31)
   HDAC complexes
    Sin3A-HDAC complex
     CAALFM_C307000WA (RPD31)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CAALFM_C307000WA (RPD31)
  Chromatin remodeling factors
   NuRD complex
    CAALFM_C307000WA (RPD31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 577 aa AA seqDB search
MYTELPFDELKVDPNQKKRIAYFYDADIGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKM
EIYRAKPATKQEMCQFHTDEYIDFISRVNPDNLDLFTKEQIKFNVGDDCPVFDGLFEYCG
ISGGGSMEGAARLNRGKCDIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVL
YIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGKGKYHSVNVPLRDG
IDDATYKSVFEPVISKIIEWYQPSAIVLQCGGDSLSGDRLGCFNLSMNGHANCINYVKSF
NIPMMVVGGGGYTMRNVARTWAYESGLLNNVKLPDELPYNEYYEYYGPDYKLDVRSSNMF
NQNSPEFLDKILTNIIANLENTKHAPSVQMNEVPNDPEDLGDVEEDTAMAIDTKGGSEMS
RDAQIQPDNEFYEDDEKDKGEKAIIDNKHEDQDSMQVDKSEEPVVEQKDKPQDENNVTGD
NIEEDQPQEVNPIEEQPSVEKSVVVVEDKLEEVKPVEQKVEEPKEVVDKPEDKHEDKPAE
TLTETTTESKPEDQPMEDAAKLTEEELKEIEELNKSS
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtatactgaacttccatttgatgaattgaaagttgatccaaaccaaaagaaacgtatt
gcttatttctatgatgctgatattgggaattatgcttatggggctggtcatcccatgaaa
cctcatcgtataagaatggcccattcattaattatgaattatggattatataaaaaaatg
gaaatttatcgagctaaaccagcaacaaaacaagaaatgtgtcaatttcatactgatgaa
tatattgattttattagtcgagttaacccagataatttagatttatttactaaagaacaa
attaaatttaatgttggtgatgattgtcccgtttttgatggattatttgagtattgtggt
attagtggtggtggatcaatggaaggtgccgccagattgaatcgtggtaaatgtgatatt
gccatcaattacgctggtgggttacatcatgcgaaaaaatctgaagctagtggattttgt
tatttgaatgatattgtgttggggatcattgaattattacgttaccatcccagagtttta
tatattgatattgatgttcatcatggtgatggtgttgaagaagcattttatactactgat
agagtaatgacttgttcttttcataaatatggtgagtttttccctggcacaggtgaatta
agagatattggggttggaaaggggaaataccattcggttaacgttccattacgtgatggg
attgatgatgctacttataaatcagtgtttgaaccagtaatatcgaaaatcattgaatgg
tatcaaccttcagccattgttttacaatgtggaggtgattccttgagtggtgatagatta
ggttgttttaatttatcaatgaatggtcatgctaattgtatcaattatgttaaatcattt
aatattccaatgatggtagttggtggaggtggttatactatgagaaatgtggctcgtact
tgggcgtatgaactgggattattaaataatgtcaaattacccgatgaattgccttataat
gaatattatgaatattatggtcctgattataaattggatgttcgatcttctaatatgttt
aatcagaattctccagaatttttagataaaattttgactaatattattgccaatttggaa
aatacaaagcatgcaccttcagtacaaatgaatgaagtccctaatgatcctgaagatttg
ggcgatgttgaagaagataccgctatggcaattgacacaaagggaggctccgaaatgagt
cgagatgctcaaatacaaccagataatgagttttatgaagatgatgaaaaagataagggc
gagaaagctataattgataataaacatgaagatcaagactctatgcaagttgataaaagt
gaagaacctgtggttgaacaaaaagataaaccacaagacgagaataacgttaccggtgat
aatatagaagaagatcaaccgcaagaagtgaacccaattgaagagcaaccttcagtggaa
aaactggtagtggtggtggaagacaaactagaagaagtgaaacctgttgaacagaaagta
gaggaaccaaaagaagtggttgataaaccagaagacaaacatgaagataaaccagcagaa
acccttacagagaccaccacagaactgaaaccagaggatcaaccaatggaagatgctgca
aagttgactgaagaagaattgaaagaaattgaagaactaaataaaagttcataa

DBGET integrated database retrieval system