KEGG   Candida albicans: CAALFM_C402300WAHelp
Entry
CAALFM_C402300WA  CDS       T00189                                 

Gene name
HOS3, CaO19.2772
Definition
(RefSeq) histone deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CAALFM_C402300WA (HOS3)
Chromosome and associated proteins [BR:cal03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CAALFM_C402300WA (HOS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl SF3A3
Motif
Other DBs
NCBI-GeneID: 3637886
NCBI-ProteinID: XP_720522
UniProt: A0A1D8PLH8
LinkDB All DBs
Position
4
AA seq 713 aa AA seqDB search
MSTSKNTLSNHDNDSEDSLIEAFETTLTIRPTTTEYEDNDISIDHTTLPHTTINSINYTR
DASIVDIEELEENEQISEQIPKFKTKRRYSLLPKITAFKKTGSPGLEEYYNQQKLDPKFD
AILKPSVLLDESLIKYNHAFDEFLRSNPHIENESPRFVHDSNKTLIVLSPYSAEHAFGRK
WVTKSYLSTIFERPQRLLASCIGVASAVSMFPFYYKVINSTKRGSVFSSHVRKIHGRNWP
KKLFELCLESHEKLNNDELEVPEDWNVGDIYLTPKTINAIEGVIGTIESAVDSLFSKRKK
ENHNLAFVVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFEQYGVTHCAILDIDLHHGDGS
QDICWERAGFTGDYGQQEEDEIVDPKLNPRDDYGKRFATYPKVGYFSIHDIKSYPTEIGY
ATKENIKNASTCIMDHDLNIWNVYLQEWSNEEEFYKHYQTKYVAILNRANQFLNSAKKQY
EQEYEEYLDNLGKYNKYLLKPHLYSQPLTKPTPPPPFKPLIAISAGFDASQYENPQMQRH
GINVPTSFYSTFTKDVVKLAKIHTNGKVLSFLEGGYSDGALSTGIFSHLIGLNNDDEFLW
NHSWGSQQVMKELVKGCKKNWSPYKKPQSDITIWANEVIKLGRAMMPNAILPTNYVYDDQ
TKQLNRPINKMVKELMDSRGEAVEVSSPIRKDPEDDRKVMRHTRSYYKKVSNI
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacttcaaaaaataccctatcgaatcatgataacgatagtgaagactcattaatt
gaagcatttgaaacaacattgactattcgtcctacaacaactgaatatgaagataatgat
atttctatagatcataccactttaccccatactaccataaacagtataaactatactaga
gatgccagtattgttgatattgaggaattggaagaaaatgaacaaattctggaacaaata
cccaaattcaaaacgaaaagacgatacagtttacttcctaaaatcactgcatttaaaaaa
accggttctcctgggttagaagaatattataatcaacaaaaacttgaccccaaatttgat
gctattttaaaaccatcagtattacttgatgaatcattgattaaatataatcatgccttt
gacgaatttttacgatccaacccccatattgaaaatgaatcacccagatttgttcatgat
tcaaataaaacattaattgtattgtcaccttactctgctgaacatgctttcgggaggaaa
tgggtcactaaatcatatttatctacaatttttgaacgtccacaacgattattggcaagt
tgtattggggtggcatcagcagtatcaatgtttcccttttattataaagtgataaattca
actaaacgaggttcagtattttcgtcgcatgttcgtaaaatccatggtcgtaattggccg
aaaaaattatttgaattgtgtcttgaatcccatgaaaaattaaataatgatgaattggaa
gtgcctgaagattggaatgttggagatatttatttaacccctaaaactataaatgctata
gaaggagtaattggaaccattgaaagtgctgttgattctttatttctgaaaaggaaaaaa
gaaaatcacaatcttgcatttgttgtcataagaccaccgggacatcatagtcatgcttgt
ttacctagtgggttttgtttattgaataatgttcaaataggtattgaatatgcttttgaa
caatatggtgttactcattgtgccattttagatattgatttgcatcatggtgatggttca
caagatatatgttgggaacgagctggattcactggagattatggtcaacaagaagaagat
gaaatagttgatcctaaattgaatccacgtgatgattatgggaaaagatttgctacttat
cctaaagttggatatttttcaattcatgatatcaaatcatatccaactgaaattggatat
gcaacaaaagagaatattaaaaatgcatctacttgtatcatggatcatgatctcaacatt
tggaatgtttatttgcaagaatggagtaatgaagaggaattttataaacattatcaaacc
aaatacgttgccatattgaatagagctaatcaatttttgaacagtgccaaaaagcaatat
gagcaagaatatgaagaatatcttgacaatttgggtaaatataacaagtatttgttgaaa
ccacatttatatagtcaaccattgactaaaccaacaccgccacctccatttaaacctttg
attgccattagtgctgggtttgatgcatcgcaatacgaaaatcctcaaatgcaacgacat
gggatcaatgtccctacatcgttttattcaacattcactaaagatgtggttaaactagcc
aaaattcataccaatggcaaagtattatcatttttagaaggtggatattctgatggtgct
ctttcaacagggatattttcccatttaattggattaaacaatgatgatgaatttttatgg
aatcattcttgggggtcacaacaagttatgaaagaattggttaaagggtgtaaaaaaaat
tggtctccgtataaaaaacctcaaagtgacattacaatttgggccaacgaagtaattaaa
ttgggtagagccatgatgcctaatgcgatattaccgacaaattatgtttatgatgatcaa
actaaacaattgaatagaccaataaataaaatggtgaaagaattgatggattctagagga
gaagctgttgaagtcagtagtccaataagaaaagatcctgaagatgataggaaagttatg
agacacacaaggtcatattacaagaaggtatccaatatatag

DBGET integrated database retrieval system