KEGG   Calothrix sp. 336/3: IJ00_16385Help
Entry
IJ00_16385        CDS       T03937                                 

Definition
(GenBank) glutathione transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
calh  Calothrix sp. 336/3
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:calh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    IJ00_16385
Enzymes [BR:calh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IJ00_16385
Transporters [BR:calh02000]
 Other Transporters
  Pores ion channels [TC:1]
   IJ00_16385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3929324..3929986
Genome map
AA seq 220 aa AA seqDB search
MLKFYYNPVSGNARRVWVALLEKRISFTPILVNLDGDQLGDEFTTINPLQRVPIIIDNGF
RVVESLAILDYLEAKYPTPSLMPTQAEDIAVVRMVEMLAINELQPAMLILTRQIVGLNVD
VVSIDNARERIMKVVKFYEDLLNGKTYFVNQQITFADIVAGTLLPSLPHFDFSLDAYPNL
QEWLQKLEQRESWQQVALKPEMIVTSLPKIRAILERRSEK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagttttactacaatccagtttccgggaatgcacgtcgagtttgggtagcatta
ctagaaaaacgcatctcttttacaccaattttagtcaatctcgatggtgatcagctaggt
gacgaatttacgactattaatcccctgcaacgtgttcccataattattgataatggattc
cgtgtggtagaatctttagctattttggactatttagaggcaaagtatcctactccatct
ttaatgccaactcaagctgaagatattgccgtagtgcggatggtagaaatgcttgctatt
aatgaacttcagccagcaatgctgatactaactcgccaaatagtgggactaaatgttgat
gttgttagcatagataatgctcgagaaagaatcatgaaagtggtaaaattctatgaggat
ttgttgaatggtaagacttattttgtcaatcaacaaattaccttcgcagatattgttgcg
ggaacactacttccttctttacctcactttgatttctcccttgatgcttacccaaatcta
caagaatggctacaaaaattagaacagagggaaagttggcaacaagtggctttgaaacca
gaaatgatagtaacatctctccctaaaattcgagcaattttagaaagacgctccgagaaa
taa

DBGET integrated database retrieval system