KEGG   Calothrix sp. PCC 6303: Cal6303_2062Help
Entry
Cal6303_2062      CDS       T02372                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K11951  
bicarbonate transport system permease protein
Organism
calt  Calothrix sp. PCC 6303
Pathway
ABC transporters
Module
Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:calt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cal6303_2062
Transporters [BR:calt02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    Cal6303_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2456370..2457215)
Genome map
AA seq 281 aa AA seqDB search
MTTVQRRSTNPKLNAGNNFISSLQKQFPDFIPPAIALLIFLAIWQLFALTPGATLPGPIQ
VIQDTWILILYPFYDKGGTDKGLFWQILGSLQRVAIGYTLAAIVGIALGVLIGVNRTMSK
ALDPLFQLFRTVPPLAWVPISLAALQKNEPAALFVIFITAIWPILINTAVGVTQIPQDYN
NVAKVLQLSRKDYFINILIPAALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGIFIWN
AYQTNKVSEVILALIYIGVVGLILDKLMAALQNWILPAEQK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgtacaaagacgctctactaaccccaagctaaatgctggtaataactttata
tccagtctgcaaaagcaatttcctgattttatcccacctgcgatcgcgcttttgatcttt
ctcgctatatggcaactatttgccttgactcccggtgcgacattaccaggtccaatacaa
gtaatacaagatacctggatattgattttgtaccctttttatgataagggcggtactgat
aaagggcttttttggcagattttaggcagtttgcaacgagttgcaatcggttatacccta
gcggcaattgttggtattgctttaggtgttttgattggtgttaatcgaacaatgtctaaa
gccttagacccccttttccaactgttccgaactgtaccacccttggcttgggtaccgatt
tctttagcagcgctacaaaaaaatgaaccagcagccctattcgtaattttcatcactgca
atttggccgatcttaattaatactgctgtgggtgtaactcaaattccccaagattacaac
aacgttgccaaagttctacaacttagccgcaaagactatttcatcaatattttgattcct
gctgcattgccctacatttttactggcttaagaattgccattggtttagcttggttagca
atcatcgccgcagaaatcgtcatgtcaggtattgtcggaattggtattttcatctggaat
gcatatcagactaacaaagtcagtgaagtaattttggctcttatttatatcggtgttgtc
ggtttgatcctagataagttgatggctgccttgcaaaactggattttaccagcagaacaa
aagtag

DBGET integrated database retrieval system