KEGG   Citrobacter amalonaticus Y19: F384_04860Help
Entry
F384_04860        CDS       T03934                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
cama  Citrobacter amalonaticus Y19
Brite
Enzymes [BR:cama01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     F384_04860
Lipid biosynthesis proteins [BR:cama01004]
 Acyl-CoA synthetase
  Unknown
   F384_04860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1079744..1081486
Genome map
AA seq 580 aa AA seqDB search
MVYMSNRISTHSLPMRYADFSTLAEALDYAALGNAGMNFYDRRNQPEAVLEYRQLKRRAE
AGARRLLSLNLNKGDRVALIAETSVGFVEAFFACQYAGLVAVPLAIPMGVGQRDSYAAKL
QGLLASCQPAAIISSDQWLSLINVVNDHGAAIHILSNAQFNALPEKDIELPLPSPDDIAY
LQYTSGSTRFPRGVIITHREVMSNLRVISHDGIKLRDSDRCVSWLPFYHDMGLVGFLLTP
VATQLSVDYLRTQDFAMRPLQWLKLISQNRCTVSVAPPFGYDLCLRRINDNELAGLDLSC
WRVAGVGAEPISAGQLNQFGECFQRAGFDSKAFMPCYGLAENALAVSFSDEASGTQVNDV
DRDILECQGKAVAPTKNTRAISTFVNCGKALPGHRIEIRNETGSPIPEREVGHICISGPS
LMNGYFQDPVSQTEIQSTGWMDTGDLGYLLDGYLYVTGRIKDLIIIRGRNIWPQDIEYIA
EQEPEIHSGDAIAFVTSQERIILQIQCRVSCEERRAQIVHSLTARVQSEFGVSVSIELLP
PHSIPRTSSGKPARAEAKKRYLNLFGETLNSPIPVSGYAQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatatgtccaatagaatatcaactcattctcttcctatgcgttatgctgatttt
tcaaccctggcggaagctctggactatgccgctctgggaaatgcaggaatgaatttttat
gatcgacgcaatcagcctgaagctgtactggagtaccgtcagctaaaacggcgggcagaa
gccggggctcggcggttgctttcgctgaatctcaataagggcgatcgtgtcgcgctgatt
gcggaaaccagcgtgggttttgtcgaagccttttttgcctgccagtatgcgggcttagtg
gcggtaccgctggccattccgatgggcgtcgggcaacgcgattcttatgctgcgaaatta
cagggcctgttagccagttgtcagcctgcggccattatcagcagcgaccaatggctgtca
ctgataaatgttgtcaacgatcatggggcggcaatccatattctcagcaatgcgcaattt
aacgcgttgccggaaaaggatatcgaactgccactgccgtcgccggacgatattgcctac
ctccagtacacctctggcagcacgcgctttcctcgcggtgtcatcattacccaccgtgaa
gtgatgtcgaatttgcgtgtgattagtcatgatgggatcaaattgcgcgacagcgaccgc
tgcgtgtcctggctgcccttttatcatgacatggggctggtgggctttctgctgacgcct
gtggcgactcaactctccgtggactatctgcgcacgcaggatttcgccatgcgtccgctg
cagtggttgaagttaatcagtcagaaccgctgtaccgtctccgtggcgccacctttcggc
tacgatttatgcttgcgtcgcatcaatgacaacgaactggccgggttggatctctcctgc
tggcgtgttgccggggtgggggctgaacccatatctgccgggcaacttaatcagtttggt
gaatgtttccagcgcgcaggatttgacagcaaggccttcatgccgtgctacggactggct
gaaaatgcgctggcggtgagtttttccgacgaagcgtcgggtacccaggtgaatgacgtt
gaccgcgacatcctcgagtgccagggcaaagcggttgcgccaacgaaaaacacccgggcg
atttccacctttgtgaattgcggcaaagcacttccgggtcaccgtattgaaattcgtaac
gaaaccgggagcccgattcctgaacgagaagtaggccatatctgtatatccggtccgagt
ctgatgaacggctattttcaggatccggtttcgcaaacggaaatccagtcaacgggttgg
atggataccggggatctgggctatctactggatggctacctgtatgtgacgggacgtata
aaagatctgatcatcattcgtggtcggaatatctggcctcaggatattgagtatattgcc
gaacaggaaccggaaattcactctggcgatgcgatagcgtttgtgacgtcccaggagcgg
attattttacaaatccagtgccgggtcagttgtgaagaacgtcgcgcgcagatagtccac
agcctgacggcaagggtacaaagcgagtttggcgtttctgtcagtattgagctgttgccg
ccgcacagcattccgcgaacatcatccgggaaaccggcgcgggcagaagcgaaaaaacgc
tatctgaacctcttcggcgagacgctaaattcaccgatccccgtgtcgggctatgcgcaa
tga

DBGET integrated database retrieval system