KEGG   Cyclobacterium amurskyense: CA2015_3667Help
Entry
CA2015_3667       CDS       T03993                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
camu  Cyclobacterium amurskyense
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:camu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CA2015_3667
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CA2015_3667
Enzymes [BR:camu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CA2015_3667
Bacterial toxins [BR:camu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CA2015_3667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4465872..4467422
Genome map
AA seq 516 aa AA seqDB search
MKKIEIFNLNLLLGISLIISFYACGEKQDFPINEKIIFQQVYVPVIQGKTTTIAKLEIKT
EQQEMLNGLEIELQGDIDFTSLSINLLLEDGTKESLQGTFNKEEKSWSLTEEKSLPTGKL
AMNINVDLAENADLKGRFSLQVPMIEISGEKVQPSGQKENLAYRIGKSLRTEGDDGVAAF
RIPGLATSTKGTLLAVYDVRHDDSSDLQGNIDVGLSRSEDGGNTWNPMQIIMDMGEWGNL
PEDQNGIGDPSILVDPVNGDIYVVALWLHGKPGTAAWRSSEPGLTPDKTGQLMIVKSEDD
GKTWTAPSNITQPMKDASWQLFFNGPGKGIAMKDGTLVFAAQYKDHDQIPHSTIIYSKDH
GVSWQVGTGARSKTTEAQVVELSDGQLMLNMRDDRGGSRAVYTTVDMGNSWNEHSSNRGA
LVEPICMASLIRFNSEYLLFSNPASTEGRYNITVKASDDEGITWPEKYQVLLDDQKGWGY
SCMTKINEGEIGILYESSQAHMTFQILPINEIISSE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgaaatttttaacctaaaccttctattaggaatctctctgataatcagt
ttttatgcctgtggtgaaaaacaagattttccaatcaatgaaaaaataatttttcaacag
gtatatgttcccgtaattcaaggcaagacgactacaatagccaaacttgaaattaaaaca
gaacagcaagaaatgctcaatggccttgaaatagagttacaaggcgatattgattttacg
agtttatcaataaatttgctgttagaggatggtacaaaagaatcgcttcaaggaacattt
aataaagaagagaaatcttggagcttgacggaggaaaaaagcctgcctactggaaaattg
gccatgaatattaatgttgatctagcagaaaatgcagatctaaaaggtagattcagttta
caagttccaatgatagaaatctctggtgaaaaagtacagcctagtggtcagaaagagaat
ttagcctacagaatagggaaatcgcttcgtactgaaggtgatgatggagtggcagccttt
cgaattcctggacttgccacgagtacaaaaggtaccttgctggctgtttatgatgttaga
cacgatgattcctctgatttgcaaggaaatatagatgtgggcttgagtaggagtgaagat
ggaggaaatacatggaatcctatgcaaattataatggatatgggtgaatggggaaatttg
cctgaggaccaaaatggaattggagatccttctattttggtagatccagtcaatggagac
atttatgtggttgcgctttggctacatggtaagcccggaacggcagcttggagaagttca
gaacccggattgacaccagataaaacgggtcaattgatgattgtgaaatctgaggacgat
ggtaagacctggacagccccgtccaatattacccaacctatgaaggatgcctcatggcaa
ttgttctttaatgggccgggaaaaggaatagccatgaaagatggaacattggtctttgct
gctcaatacaaagaccatgatcaaattccgcacagtaccattatttacagtaaagaccat
ggtgtgtcatggcaagtgggaacaggagcaaggtcaaaaactactgaagcccaggtcgta
gagttaagtgatgggcaattaatgctaaatatgagagatgatcgaggtggttctagggcg
gtttatactacagtggatatgggcaattcctggaatgaacattcatctaaccgtggcgct
ttagttgaaccaatttgcatggctagcttaatcaggttcaattctgaatacctgttattt
tctaaccccgcatcgactgaaggtcggtataatattactgtgaaagcaagtgatgatgag
ggaataacctggcctgagaagtaccaagtattgctagatgaccaaaaaggttggggctac
agttgtatgacaaaaataaatgaaggtgaaattgggatattatacgaaagtagtcaagct
catatgacttttcaaattttaccaattaatgaaataatttcatctgaatag

DBGET integrated database retrieval system