KEGG   Cyanobacterium aponinum: Cyan10605_0221Help
Entry
Cyan10605_0221    CDS       T02376                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
can  Cyanobacterium aponinum
Pathway
can00250  Alanine, aspartate and glutamate metabolism
can00410  beta-Alanine metabolism
can00430  Taurine and hypotaurine metabolism
can00650  Butanoate metabolism
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
can01120  Microbial metabolism in diverse environments
can02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Cyan10605_0221
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyan10605_0221
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cyan10605_0221
   00430 Taurine and hypotaurine metabolism
    Cyan10605_0221
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cyan10605_0221
Enzymes [BR:can01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Cyan10605_0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFZ52375
UniProt: K9Z1C8
LinkDB All DBs
Position
277727..279127
Genome map
AA seq 466 aa AA seqDB search
MALSEKDFIREYINDDIYASVDLSKAMPKYRFPDKENEPRHVYQLIHDELMLDGNARQNL
ATFCQTWLEPEVHQLMDECIDKNMVDKDEYPQTAELESRCVHMLADLWNSPDAVNTMGCS
TTGSSEAAMLGGLAMKWRWRKKMEAQGKPTDKPNLICGPVQICWHKFARYWDIELREIPM
EENRLLMTPEEVIKRCDENTIGVVPTLGVTFTCGYEPVKAVSDALDKLQDEKGWDIPIHV
DGASGAFLAPFCVPELEWDFRLPRVKSINTSGHKFGLAPLGCGWIIWRDKEDLPEELIFK
VNYLGGEMSVFALNFSRPGGQIICQYYNFLRLGKEGYRKIQMACYETAQYLAEEIAKMEP
FEILYNGDEKSGIPAISWKIKDGYDTKGYTLYDFADRLRSRGWQVPAYSLPANCQHMVIQ
RILVRHGVSRDLASLLVEDMKRCLDYLDKHPISKPLTAQEATGYHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcactttcagaaaaagattttattcgtgaatatatcaatgacgatatttacgcatca
gttgatttatctaaagcgatgccgaagtatcggtttcctgacaaagaaaatgaaccccgc
catgtttatcaattgattcacgatgaattaatgcttgatggtaacgctcgtcagaattta
gctacattttgtcaaacttggctcgaaccagaagttcatcaactaatggatgagtgcata
gataaaaatatggtagataaagacgagtatccccaaacggcagaattagaatctcgttgt
gttcatatgttagcagacctttggaattctcctgatgcggtaaataccatgggatgttct
accactggctctagcgaagcggcaatgcttggtggattagcgatgaaatggcgttggcgc
aaaaaaatggaagcccaaggcaaacccacagacaaacctaatttaatttgtggacctgtg
caaatatgttggcataaattcgcccgttattgggatatagagttgcgggaaattcccatg
gaagaaaaccgtttattaatgactcctgaagaagtaattaagcgttgcgatgaaaatacc
attggcgttgtgccaacccttggagtaacttttacctgtggctatgaacccgtaaaagca
gttagtgatgctttagataaactacaagatgagaaaggttgggatataccgattcatgtg
gacggggctagtggggcttttcttgctcctttttgtgttccagaattagaatgggatttt
cgcctgcctcgtgttaaatcgatcaatacctctggacataaatttggtttagcacctcta
ggatgtggttggattatttggcgtgataaggaagacttacccgaagaactaattttcaaa
gtcaattatctaggcggagaaatgtcggtattcgctctcaatttttctcgtcccggaggt
caaattatttgtcaatactataattttttgcgtctgggaaaagaaggctaccgcaaaatt
caaatggcttgttatgaaactgctcaatatttagccgaagaaatagcaaaaatggagcct
tttgagattctatataatggcgatgaaaaatcagggattccagccataagttggaaaatc
aaagatggttatgacacaaaaggctataccctttatgattttgccgatcgcctccgttct
cgtggttggcaagttcccgcttattctttacccgctaattgtcaacatatggttattcaa
cgtattttagttcgccatggtgtcagtcgagacttagcatctttattagttgaagatatg
aagcgttgtcttgattatttggacaaacatcccatttctaaacctttaactgcccaagaa
gcaaccgggtatcatcattaa

DBGET integrated database retrieval system