KEGG   Cyanobacterium aponinum: Cyan10605_1364Help
Entry
Cyan10605_1364    CDS       T02376                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
can  Cyanobacterium aponinum
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Cyan10605_1364
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cyan10605_1364
Transporters [BR:can02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Cyan10605_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1636091..1636915
Genome map
AA seq 274 aa AA seqDB search
MANSSINLRLRKKNPLSFLYSKKVIRPAVAIIVFLVIWQIVCTGQNSNLPSPVQVFEDTY
PLIIDPFFDNGGTDKGLAIQIFASLTRVAIGFSLATIVGIGLGILIGANKIIYDAVDPIF
QVLRTIPPLAWLPIALAAFQEAEPSAIFVIFITAIWPIIINTTVGVQKIPQDYTNVSRVL
KLSKTEYFFNILFPASVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNSSLM
SEIIIALIYVGIVGLLLDRFVGFIASIVVPGEQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctaattctagtattaatttaagactccgtaaaaaaaatcccctcagctttttgtat
tctaaaaaagtaattcgtcctgcggttgctatcatcgtatttttagtaatttggcaaatt
gtctgtacaggtcaaaattcaaatttacctagtcctgttcaggtttttgaagatacttat
ccgttaattattgacccattttttgataatgggggtacagataaaggattagcaattcaa
atttttgccagtttaacaagagttgcgattggattctctttagccacaatagttgggatt
ggtttaggtattttaattggggcaaataaaattatttatgatgcggtagatcccattttc
caagtattaagaactattcctcctcttgcttggctacccattgctttagcggcatttcaa
gaagcagaaccctcggcaatttttgttattttcattactgctatctggcctattattatt
aacacaacagtaggagtgcaaaaaattccccaagattataccaacgtttctagggtatta
aaattatccaaaactgaatacttttttaacatcttatttcctgcttcagttccctatatt
tttactggtttaagaataggtatcggcttatcttggttagcaattgttgccgcagaaatg
ttaattggtggtgtgggtattggcttctttatctgggatgcttataacagttctttaatg
agtgaaattattattgctttaatctatgtgggtatagtcggtttattactagatagattc
gttggttttattgccagtattgtcgttccgggtgaacaaaaatag

DBGET integrated database retrieval system