KEGG   Capsicum annuum: 107840969Help
Entry
107840969         CDS       T04646                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cann  Capsicum annuum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cann00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107840969
   00051 Fructose and mannose metabolism
    107840969
   00052 Galactose metabolism
    107840969
   00500 Starch and sucrose metabolism
    107840969
   00520 Amino sugar and nucleotide sugar metabolism
    107840969
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107840969
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107840969
Membrane trafficking [BR:cann04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107840969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 499 aa AA seqDB search
MGKLVVCVAVVCTAAVCGAAAVLLMMRRMKNCGEWGKAMAMLKEFEEKCATPVEKLRQVA
DAMSVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVMRVQLGGKEN
RIVKHEVKEVSIPQNVMAGSSSDVLFDFIATALAEFVATEGDDFHLPPGRQRELGFTFSF
PVKQLSIASGTLIKWTKGFSIEDVVGQDVVGELTKAMERVDLDVRVAALVNDTVGTLAGG
RYNNPDVIAAIILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFHSTHLPVTEY
DQNLDAESLNPAEQIYEKMISGMYLGEILRRVLCRMAEEASLFGDYVPQRLKIPFILRTP
DMAAMHHDESADLKVVGNKLKDILEVPNSTLKTRKIVVELCDIITSRGAHLSAAGIVGIL
KKLGIDTLKNGEKHRSVVAVDGALFEHYTKFRNCMEGTIKELLGDAADSIVIELSSDGSG
VGAALLAASHSQYLGLDES
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattggtagtgtgtgtagcagttgtatgtactgcagcagtatgtggtgctgca
gcagttttgttaatgatgaggaggatgaagaattgtggtgagtggggaaaggctatggct
atgttgaaagagtttgaggagaagtgtgcaactccagtagaaaaacttaggcaagtggct
gatgctatgagtgtagagatgcatgctggacttgcttctgaaggcggaagtaaacttaag
atgcttattagctatgttgataatctccctactggggacgaacaaggtctgttttatgca
ttggatctaggcggtacaaacttccgtgtgatgcgtgtgcagttgggtgggaaagaaaac
cgtatagttaaacatgaagttaaagaagtttcaattccacagaatgtgatggctggatca
tcatccgatgtgttatttgattttattgccacggcacttgcagaattcgtagctacagaa
ggtgatgattttcatcttccacccggtagacaaagggagttaggctttaccttctctttc
ccagtgaaacaattgtcgattgcatcaggaactcttattaaatggacaaagggcttctcc
atagaagatgtggttggccaagatgtggttggggaattaacaaaagcaatggaaagggtc
gacctcgatgtgcgtgtggctgctttagtcaacgatactgttggaacgttagcaggaggt
cggtacaataatcctgatgtcattgctgccataatattgggtactggaaccaatgcagca
tatgttgagcgggcacacgcgattccgaaatggcatggcctgctgccgaaatcaggagag
atggtaatcaacatggaatggggtaatttccattcgacacatcttccagtaacagaatat
gaccaaaatcttgatgctgagagtttaaaccccgcggaacagatttatgagaagatgatt
tctggcatgtatctcggagaaattttgcgtagagtattgtgtagaatggctgaagaagct
tcattattcggtgattatgtaccacagagactgaaaattccgttcatattgaggactccg
gacatggctgctatgcatcacgacgagtctgctgatctcaaggtggttggcaataagttg
aaggatatcttagaggtgcctaattctaccttgaaaacgaggaaaatagttgtggagcta
tgcgacattatcacctctcgtggagctcatctttctgcagcagggatcgtggggatcctc
aagaaattaggaatagacactttgaagaacggagagaagcataggtctgtcgtagctgta
gatggtgcattgttcgagcattacacaaagttcagaaattgcatggaaggaactattaaa
gagttactgggagacgccgctgacagcatagtcattgagctctcgagcgatggttcaggc
gttggcgcagcacttttggctgcatctcattcacaataccttggacttgacgaatcttga

DBGET integrated database retrieval system