KEGG   Capsicum annuum: 107854027Help
Entry
107854027         CDS       T04646                                 

Definition
(RefSeq) thymidine kinase-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cann  Capsicum annuum
Pathway
cann00240  Pyrimidine metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    107854027
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     107854027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2 AAA_27
Motif
Other DBs
NCBI-GeneID: 107854027
NCBI-ProteinID: XP_016554516
UniProt: A0A2G2YU09 A0A1U8F762
LinkDB All DBs
Position
Un
AA seq 227 aa AA seqDB search
MSFSNSSLKNPVSVPNDTGEIHVIFGPMFAGKTTALLRRVNSESNLGRNVVMIKSNKDTR
YAVDAVVTHDGTKFPCWALPDLSSFKHRFGLDAYEKVDVIGIDEAQFFDDLYDFCCNAAD
IDGKTVIVAGLDGDYLRRKFGSVLDIIPIADTVTKLTARCELCGKRAFFTLRKTDEMQKE
LIGGANMYMPVCRQHYVNGKSIVESARKVLESHQVQVELVSEKPLVA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttctaattcatcattgaaaaatccagtttctgtgcctaatgatactggcgaa
attcatgtaatatttgggcctatgtttgctggtaaaactactgctcttcttcgtcgggtt
aattctgaatccaatttgggcaggaatgtggttatgatcaagtcaaacaaagatacacgg
tatgcagtagatgcagtggtgacacatgatgggacaaaattcccatgttgggcattgcct
gatctatcatctttcaaacacagatttggtctagatgcctatgaaaaggtggatgtgatt
ggcattgatgaagctcagttttttgatgacctttatgatttctgctgcaatgctgctgat
attgatgggaagactgtaattgttgctggcctagatggtgactacttaaggaggaagttt
ggctctgtacttgatattattccgattgcagatactgttacaaagttgacagcaagatgc
gagttatgtggcaaacgcgcatttttcaccttgagaaaaactgatgagatgcagaaggag
cttataggtggtgctaatatgtatatgcctgtctgtcgacaacactatgtcaatggcaag
tcgatcgtggaatctgcaagaaaggtcctcgaatctcatcaagtgcaggttgaactagtt
tcagagaagccactagttgcttag

DBGET integrated database retrieval system