KEGG   Capsicum annuum: 107855428Help
Entry
107855428         CDS       T04646                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cann  Capsicum annuum
Pathway
cann00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cann00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    107855428
Enzymes [BR:cann01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107855428
Transporters [BR:cann02000]
 Other Transporters
  Pores ion channels [TC:1]
   107855428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 107855428
NCBI-ProteinID: XP_016555929
UniProt: A0A1U8FHY9
LinkDB All DBs
Position
Un
AA seq 251 aa AA seqDB search
MKTGQKEQNLQTNCISVSQFYRISTGKMREVKVIGSSASLFYTRVEWALKLKGVTYEYIQ
EDLLNKSELLLRSNPVHKKIPVLLHDDKPVAESLVILEYIDETWKGYSLLPQDPYERATA
RFWAKFVDEKCVIGSWQAMAAEGEAKEKAIESVQEQYAFIEKQIRGKKFFGGEQIGYLDL
VMGWKTLWLNAMEELGIMKLLDPEKFPSLHQWTENFKQIPIIQESMPPQESLVNYFQGGL
NYVRSLAANKP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggacagaaagagcagaatcttcaaacaaattgcatatcagtaagccaattc
tatagaatttccactgggaaaatgagagaagtgaaggtgatagggtcatcagcaagccta
ttttacaccagagtggaatgggctttgaagctcaaaggggttacctatgaatatatacaa
gaagatttactgaacaagagtgagttgctcctcaggtccaaccctgttcacaagaagata
cccgtgctactacacgatgacaaacccgttgctgaatcacttgtgattcttgaatacatc
gatgaaacgtggaaaggatactctttgttgcctcaagatccatatgaaagagcaacagct
cgtttctgggcaaaatttgttgatgagaagtgtgtcataggatcatggcaagcaatggca
gctgaaggagaggcaaaagaaaaagctatagagtcagtacaggaacagtatgcatttatc
gagaagcagatccgagggaagaagtttttcggtggggagcagataggctacctggatctc
gtgatgggttggaaaactctttggctcaacgccatggaggaattaggaattatgaagtta
cttgatccagagaagttcccttcactccatcaatggactgaaaacttcaaacagatccct
attatacaagaaagcatgccaccacaagagagcctagtcaactacttccaaggtggtcta
aactacgtgcgttccctagcagcaaacaaaccatga

DBGET integrated database retrieval system