KEGG   Cellulophaga algicola: Celal_2026Help
Entry
Celal_2026        CDS       T01404                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cao  Cellulophaga algicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celal_2026
  Amino acid metabolism
   00310 Lysine degradation
    Celal_2026
   00380 Tryptophan metabolism
    Celal_2026
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Celal_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2307954..2310743
Genome map
AA seq 929 aa AA seqDB search
MDKYSFLNAAHTSFFAELYDKYLINPDSVEPSWRAFFQGFDFGQESLLDELDLPVTPNNV
AAPSGTSEMPQSLQKEFQVIRLIDGYRSRGHLFTKTNPVRERRKYEPTLAIENFGLSSED
LNTVFTAGEILGIGPNTLTEIISHLTNIYCDAIGVEYMYIRSPERIKWIQDWLNVNDNHP
NYDAEQKKKILRKLNQAVSFESFLHTKYVGQKRFSLEGNESLIPALDAIVERAAVMGVEQ
FVMGMAHRGRLNVLTNIFGKAAKDIFSEFDGKDYEQVIFDGDVKYHLGWTSERMSDNGNK
IKMNIAPNPSHLETVGAVVEGITRAKQDTHYKEDFSKVLPIVVHGDAAIAGQGLVYEVIQ
MANLDGYKTGGTIHMVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVH
ASLFALEYRMRYKRDVFLDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHESPRDIYAAKLI
AEGIIDENYIGKLEQEYKDSLETELEDSRKEDKTVITPFMADEWKGFVRVQEDEMVKPID
TSYPQDKLTQIANSLTSLPKGKKFLRKVDKLIEDRRKMFFENDKLDWAMGELLAYGSLLQ
EGFGVRMSGQDVERGTFSHRHAVVKVEDSEEEVVPLNLIEGKKGDFHIFNSHLSEYGVVG
FDYGYAMASPNTLTIWEAQFGDFSNGAQIMIDQYISAAEDKWKLQNGLVMLLPHGYEGQG
AEHSSARMERFLQLCASDNMFIADVTTPANMFHLLRRQMKANFRKPLVVFTPKSLLRHPK
AVSTVDEFANGGFQEVIDDSAADVKKVKTLVFCTGKFYYDLLAAREENAREDVALVRVEQ
LFPLPASKMKALMKKYTKADDVVWAQEEPRNMGAWSFIMMHFSEASKVRVASRRFYASPA
AGSAVRSKRRHQEVIDYVFDKTKDNMIRK
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttaaacgctgcgcatacttcgttttttgcagagttatatgac
aagtatttaattaatccagatagtgttgagcctagttggcgcgcattttttcaaggattt
gattttggccaagagagtcttttagatgaacttgacttgccagtaacaccaaataatgtt
gctgcaccatctggcacttcagaaatgccacaatcactacaaaaagaatttcaggttatt
cgattaattgacgggtatagatctcgtggacatttgtttacaaaaacaaaccctgttcgt
gagcgaagaaaatacgagccaacgttagctattgaaaattttggcttatcctcagaagat
ttaaatacggtgtttaccgcaggagaaattttaggcataggtccaaataccttaacggag
ataatttcgcacttaaccaatatctattgtgatgcaataggggttgagtacatgtatatc
agaagtcctgagcgaattaagtggattcaagattggctaaatgtcaatgataaccatcct
aattatgatgcagaacaaaagaaaaaaattcttagaaaactaaatcaggcagtttctttt
gaaagctttttgcatacaaaatatgtaggtcaaaaacgtttttctttagaaggtaatgag
tcgctaatacctgctttagatgctattgtggaacgcgctgcagtaatgggtgttgagcag
tttgttatgggtatggcgcataggggtagactaaatgtgcttaccaatatttttggtaaa
gccgctaaagatatctttagcgaatttgacggtaaagattacgagcaagtaatttttgat
ggtgatgttaaatatcacttgggttggacttctgaaaggatgtctgataatgggaataaa
ataaaaatgaacattgcgcctaatccatctcacttagagactgttggtgcagttgtagaa
ggtataacaagagcaaaacaagatacacattacaaagaggacttctctaaagtgttacca
attgttgtgcatggtgatgcagccattgcagggcaaggtttggtgtatgaagttatccag
atggctaatcttgatggttataaaactggtggtacaatccatatggtggtaaataaccaa
ataggttttacaacaaattacctggatgctcgtagttctacttattgtacagatgtaggt
aaagtaactttgagtccagttttacatgttaatgctgatgatgcagaagctgttgttcat
gcttctttattcgctttagaatacagaatgcgttataagcgagatgtttttcttgattta
ttagggtaccgaaaatatgggcataatgaaggtgatgagcctcgttttacgcaacctaaa
ttatacaaagcgatagccaaacatgaaagtccaagagatatttatgcagcaaagcttatt
gcagaaggtattatcgatgaaaattacattggtaaattagagcaagaatataaagattct
ttagaaacagaattagaagattctcgtaaagaagataagaccgtaatcacgccatttatg
gcagatgaatggaaaggttttgttcgtgttcaagaagatgagatggtaaagccaattgat
acttcttatccgcaagataaacttacgcaaatagctaattctcttacgagtctaccaaaa
ggtaaaaagtttttacgtaaagtagataagcttattgaggatcgaagaaaaatgttcttt
gagaatgataagttagattgggctatgggagaactgttagcatacggatctttattgcaa
gaaggttttggcgttagaatgtctggtcaagatgtagaaagaggtactttttctcaccgt
catgcagttgtaaaagttgaggatagtgaagaggaagttgttcctttaaatttaatagaa
ggtaaaaagggcgatttccatatatttaattcacacctttcagaatatggggtggtaggt
tttgattatggttatgccatggctagccctaatacacttactatttgggaagcgcaattt
ggagatttcagcaatggagctcaaattatgattgaccaatatatttctgcagcagaagac
aagtggaaattacaaaacggtttggtaatgttactgccacacggttatgaaggtcagggt
gcagaacattcttctgcacgtatggagcgttttttacaactttgcgcaagtgataatatg
tttatagcagatgttacaacgccagcaaatatgtttcacctattacgtagacagatgaag
gcgaattttagaaagcctttggttgtatttacgccaaaaagtttattgcgtcatccaaaa
gcagtatctactgtagatgagtttgctaatggtggttttcaagaggtgatagatgatagt
gccgctgatgttaaaaaagtaaaaactctcgtattctgtacgggtaaattttattatgat
ttattagcagctcgtgaagaaaatgctagagaagatgtcgctttagttcgtgtagagcaa
ttatttccattaccagctagtaaaatgaaggcgttaatgaagaaatatacgaaggcagat
gatgttgtttgggcacaagaagagcctaggaatatgggagcttggagttttattatgatg
cactttagtgaggctagtaaagtaagagtagcttcaaggcgtttttatgcgtcaccagca
gcgggtagtgcagtgcgctctaaacgtcgtcatcaagaagtgatagattatgtttttgat
aagacaaaagataacatgattcgtaagtaa

DBGET integrated database retrieval system