KEGG   Caldilinea aerophila: CLDAP_00250Help
Entry
CLDAP_00250       CDS       T01797                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cap  Caldilinea aerophila
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CLDAP_00250
   00650 Butanoate metabolism
    CLDAP_00250
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLDAP_00250
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLDAP_00250
Enzymes [BR:cap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CLDAP_00250
Amino acid related enzymes [BR:cap01007]
 Aminotransferase (transaminase)
  Class III
   CLDAP_00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(27686..28996)
Genome map
AA seq 436 aa AA seqDB search
METQEILEKQRKFLWPNHILYYTEPLPLSHGEGVYVWDTNGRQYLDFFGGILTTSVGHNN
PHVVTRVREQVGKLIHSSTLYPNENHVALAEKLADITPGRLQMSYFTNSGSEANETAIVA
AQTYTDNREVVALRHAYSGRTSLTMSVTAHSTWRVGKSFSPDIKHAINPYCYRCPLKLTY
PACDVACAQDIEDVIRTTTSGRIAAFMAEPIQGVGGFITPPDEYFKIAVEIARHYGGVFI
CDEVQTGFGRTGTYWFGITHWGVEPEIMTMAKGIANGLPMGNTITTPEIAQAMVGKGLTI
STFGGNPTSCAAALGTLEALEAAGGPQRFADLGARLRRGLEQLGEKYPLIGEVRGKGLMQ
GIEMVTDRQSKEPAPKAVAQLFEETRTRGLLVGKGGLYGNVIRIAPPMTVTEEQIDRALE
ILDHALAAVHETHGVG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggagacacaggagattctggagaagcagcgtaaatttctgtggccaaaccacattctg
tattacaccgagccgttgccgctctcacatggcgagggcgtctatgtctgggacacaaac
ggtcggcaatatcttgactttttcggcggcatcctgaccactagcgtcggacataataac
ccccacgtggtgacgcgcgtgcgcgaacaagtgggcaagctgattcattcctctacgctc
taccccaatgagaatcacgtggcgctggcggagaaactggccgacatcacgccgggacgg
ctgcaaatgtcatacttcaccaactctggcagcgaggcgaacgagacggccatcgttgct
gcgcagacctacaccgacaaccgcgaggttgtggcgctgcgtcacgcctacagcggtcgt
acctccttgacgatgagcgtcaccgcccattcgacctggagagttggcaagagcttcagc
ccggatattaaacatgccattaacccctactgctatcgctgtcccctgaagctgacctat
cctgcctgcgacgttgcctgcgcccaggacatcgaagacgtcatccgcacgacaacttcc
ggccgtatcgccgcctttatggcggagccgatccagggcgtcggcggtttcatcacgccg
cccgatgaatacttcaagattgcggtggagatcgctcgtcactatggcggcgtctttatc
tgtgacgaggtgcagaccggcttcggacgtaccggcacgtactggttcggcattacgcac
tggggggtagaaccggagatcatgaccatggccaagggtatcgccaacggcctgccgatg
ggcaacacaatcaccacgcctgaaattgcccaggccatggtcggcaagggcctgaccatc
agcaccttcggcggcaacccgacctcctgcgccgccgcgctgggcacactggaggcgctg
gaggcggcgggcggcccacagcgcttcgccgatctgggggcaaggttgcgcagggggctg
gagcaactgggcgaaaaatacccgctgatcggcgaggtgcgtggcaaagggctgatgcag
ggcattgagatggtgaccgaccgccagagcaaagagccggcaccaaaggccgtcgcccag
ctctttgaggagacgcgcacgcgcgggctgctggtcggaaagggcggcctttacggcaat
gtcatccgcattgcaccgccgatgaccgtcaccgaggaacagatcgatcgtgccctggag
attctcgaccacgcgctggctgccgtgcatgagacgcacggtgtgggatga

DBGET integrated database retrieval system