KEGG   Caldilinea aerophila: CLDAP_31290Help
Entry
CLDAP_31290       CDS       T01797                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cap  Caldilinea aerophila
Pathway
cap00620  Pyruvate metabolism
cap00680  Methane metabolism
cap01100  Metabolic pathways
cap01120  Microbial metabolism in diverse environments
cap01200  Carbon metabolism
Module
cap_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLDAP_31290 (ppc)
  Energy metabolism
   00680 Methane metabolism
    CLDAP_31290 (ppc)
Enzymes [BR:cap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CLDAP_31290 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAM01169
UniProt: I0I7D1
LinkDB All DBs
Position
3894807..3897563
Genome map
AA seq 918 aa AA seqDB search
MNEAQQQRLSANIHLLGDMLGETIIEQEGQAVFELEEQIRALAKAWRAGDASAGEAIKAL
MPSLIEDLPRTIAVLKAFTTYFQLVNLAEDEQRIEILRDRAREAQMTGVPMRETLYESIA
RLREEGLSAEDVQRILDNLYIVPVLTAHPTETKRQTILTKLRTISDTLEQITSPGLLPSE
ERELRERLREDIALLWQSDETRDRPPTVMDEVRTGLYFYEVTIFKLIPKIYEELERSLAE
VYPGVKFRIPPFLRYGSWIGGDRDGNPNVTLSVTEEALRAMKETVLKQYNIAIDELYQHL
IPAITRVNISDELRESIAADLKLVPEEEVEVLERFRMEPYRQKLIMMFRRLRATRAENER
PWDDRERNPRAYRNVDEFMNDLRIIERSLLANKGERLARGRLATLIRQVEVFGFHLATLD
MRQHSSRHRDAIAEIFATYAICPDYQALSEADKVSLLTREILNPRPLTAQLHFSEPTNET
VALFRLMRRAKQEVDEDAVQTYIISMTNSVSHVLEVLLLVKDAGLMGRIDIVPLFETVSD
LDAAPHIMATLFENPAYRRHLELRGWRQQVMIGYSDSNKDGGYLRANWMLFLAQRTLARL
CDQFKVQLTLFHGRGGTLGRGGGPANRAILAQPPESVRGRVRLTEQGEVISLRYSNMALA
RRHLEQLVNAVILTAGKRPHFPKEEEWAQRMDKLSDIAFRKYRSLVTKPGFITYFHEATP
IDHISALNIGSRPARRKATQDISDLRAIPWVFAWTQSRVNLPTWYGVGAALEAWCRGGED
AEKLAELREMYRQWPLFTNILDNVQMGLAKADMAIASLYSELTDETTRSAIFTDILDEFQ
RTERMVLLVVESDHLLSKEPVLRRSIKVRNPYVDPMNYIQVALLHRLKTERDPERRRRLT
AAVLSSVNGIAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcgcaacaacaacggctgagcgcgaacatccacctgctcggcgacatgctg
ggcgaaaccatcatcgagcaggaaggtcaggcggtttttgaattagaggagcaaattcga
gcgctggccaaagcctggcgcgccggcgatgcctcggcgggagaggcgatcaaggccctg
atgccttcgctcatcgaagacctgccgcgcaccatcgcagtgctcaaggcgtttacgacc
tatttccagttggtgaacctggccgaggacgaacagcgcatcgaaatcttgcgcgatcgc
gcgcgcgaggcgcagatgaccggcgtgccgatgcgcgagacgctctatgaatccatcgcc
cgcctgcgcgaggagggattgtctgcagaggatgtacagcgcatcctggacaatctctac
attgtgccggtgctcacggcgcatcccaccgaaaccaaacgccagacgatcctgaccaaa
ctgcgcaccattagcgacacgctcgaacagatcacctcgccgggccttctccctagcgaa
gaacgggagctgagggagcgcctgcgcgaggacattgccctcttgtggcagagcgatgag
acgcgcgatcggccgccaactgtcatggatgaggtgcgcaccggcctttacttttacgaa
gtcaccattttcaagctcattcccaaaatctacgaagagcttgagcgcagcctggcagaa
gtctatccaggcgtcaaattccgcattccccccttcctgcgctacggctcctggatcggg
ggcgatcgcgatggcaaccccaacgtgacgctgagcgtgaccgaagaagccctgcgcgcc
atgaaagagacggtgttgaagcaatacaacatcgccatcgacgaactgtaccagcacctg
atcccggcgatcacgcgggtcaacatcagcgacgaactgcgcgagagcatcgccgccgac
ctgaaactggtgcccgaagaagaggtcgaggtgctggaacgcttccgcatggagccgtat
cgccagaagctcatcatgatgttccgtcggctgcgcgccacgcgcgccgaaaatgaacgc
ccatgggacgatcgggagcgcaacccacgcgcctatcgcaacgtggatgagttcatgaat
gacctgcgcatcattgagcgcagcctgctggccaataagggcgaacgcctggcgcgcggc
cgattggcgaccctcattcgccaggtggaggtcttcggctttcacctggccacgttggac
atgcgacaacattcttctcgtcatcgtgatgcaattgcagaaatttttgccacgtacgcc
atctgtcccgactatcaggctctcagtgaagccgacaaagtcagcctgctcacgcgtgag
attctcaacccgcggccactgaccgcccaactccacttttcagagccgaccaatgagacg
gtggcgctcttccgcctgatgcgccgagccaaacaggaagtcgacgaggacgcggtgcag
acctacatcatcagcatgaccaattcggtgagccacgtgctggaggtcctgctgctcgtc
aaggacgccggcctgatgggacgcatcgacattgtgccactcttcgagacggttagcgac
ctggatgctgcgccccatatcatggcgacgctctttgaaaaccctgcctatcgccgtcac
ctggaactgcgcggctggagacaacaggtgatgatcggctacagcgactcgaacaaagat
ggcggctacctgcgcgcaaactggatgctcttcctggcacagcgcacgctggcacgtctg
tgcgaccagttcaaggtgcaactgacgctcttccatggccgcggcggcacgctgggacgc
ggcggcggcccggcaaatcgcgccattctggcacagccacctgaatcggtacgcggccgt
gtgcgcctgaccgaacagggagaggtgatcagcttgcgctactccaacatggcactggcg
cgtcgccacctggagcaactggtcaacgcagtgatcttgacggcaggtaagcggccccat
ttccccaaagaagaggaatgggcgcaacgcatggacaagctgagcgacattgcgttccgc
aaatatcgctcgttggtcaccaagccaggatttatcacctatttccatgaagcaacgccc
attgaccacatcagcgcgctcaacatcggctcgcggccggcgcggcgcaaggctacgcaa
gatatcagcgacctgcgggcgattccctgggtcttcgcctggacgcaatcgcgcgtcaat
ttaccgacctggtatggcgttggcgcagccctggaagcatggtgccggggtggagaggat
gcggaaaagctggccgagctgcgcgaaatgtatcgccagtggccactcttcaccaacatc
ctcgacaatgtccagatggggctcgccaaggcggatatggcgatcgcgtcgctctactcc
gagctgaccgacgaaacgacgcgcagcgccatcttcaccgacattctggacgagtttcag
cgcacagagcgcatggtgttgctggtggtcgagtccgatcacctgttgagcaaggagccg
gtgctgcgtcgcagcatcaaagtgcgcaatccatatgtggatcccatgaactacattcag
gtagcgttgttgcacaggctgaagaccgaacgcgaccccgagcggcgacgacggctgaca
gcggctgtgctcagctccgtaaacggcattgcagccggtctgcaaaacacagggtga

DBGET integrated database retrieval system