KEGG   Corynebacterium aquilae: CAQU_03340Help
Entry
CAQU_03340        CDS       T05112                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
caqu  Corynebacterium aquilae
Pathway
caqu00010  Glycolysis / Gluconeogenesis
caqu00071  Fatty acid degradation
caqu00350  Tyrosine metabolism
caqu00625  Chloroalkane and chloroalkene degradation
caqu00626  Naphthalene degradation
caqu01100  Metabolic pathways
caqu01110  Biosynthesis of secondary metabolites
caqu01120  Microbial metabolism in diverse environments
caqu01130  Biosynthesis of antibiotics
caqu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:caqu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAQU_03340
  Lipid metabolism
   00071 Fatty acid degradation
    CAQU_03340
  Amino acid metabolism
   00350 Tyrosine metabolism
    CAQU_03340
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CAQU_03340
   00626 Naphthalene degradation
    CAQU_03340
Enzymes [BR:caqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CAQU_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C adh_short AlaDh_PNT_C Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: APT84260
UniProt: A0A1L7CEF2
LinkDB All DBs
Position
750826..751854
Genome map
AA seq 342 aa AA seqDB search
MSEKFTAAVAEEFGPTLNVTDIDLPQPGRNQALVKLHTSGVCHTDLHAVEGDWPVKPGLP
FVPGHEGVGEVVALGEGDHADIEVGSMVGNVWLWSACGTCEYCRTGRETYCPNAEYGGYT
VDGSFGQYMLVDTRYCARIPDGADLLEVAPILCAGVTVYKGLKETETRPGQFVVISGVGG
LGHIAVQYAVAMGMRVIAVDIAEDKLALAKKHGAEYTVNAREVDPGQAVVEYTGGGSHGV
LVTAVHEAAFGQAIHMARKGGTIVFNGLPPGDFPAPIFDIVFKGLTIRGSLVGTRQDLAE
ALDFYARGHIHPTVTECALEDVNEVFEKLRQGTVDGRMAIRY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaagttcaccgcagcggtggccgaggaattcggccccaccctcaacgtcacc
gacatcgacctgccgcagcccggccgcaatcaagcgctggtcaaactgcacacctccggg
gtctgccacaccgacctgcacgccgtggaaggcgactggccggtcaagcccggactgccc
ttcgtgcccggccacgagggcgtgggcgaggtggtagccctcggcgagggggaccacgcc
gacattgaagtcggctcaatggtcggcaatgtgtggctgtggtctgcctgcggcacctgc
gaatactgccgcaccggtcgcgaaacctattgccccaatgcggaatatggcggctacacc
gtcgatggctccttcggccagtacatgctggtcgacacccgctactgcgcccgcatcccg
gacggtgctgacctgcttgaagtcgcccccatcctgtgcgccggcgtcaccgtctacaag
gggctgaaggaaacagagactcgccccggccagttcgtggtgatctccggtgtcggcgga
ctaggtcacattgccgtccagtacgccgtcgccatgggcatgcgcgtcatcgcggtcgat
atcgccgaggacaagctggcgctggccaagaaacacggtgccgaatacacggtcaacgcc
cgcgaggtcgaccccggtcaggccgtggtggaatacaccggcggcggctcccacggcgtg
ctggtcaccgccgtacacgaggcagccttcggccaggccatccacatggcccgcaagggc
ggaaccatcgtgtttaacggcctgcccccgggagacttccccgcaccgatcttcgacatc
gtcttcaagggtctgaccatccgcggctccctggtcggaacccggcaggatctggcggaa
gccctcgacttctacgcccgcggccacattcaccccacggtgaccgaatgcgccctcgaa
gacgtcaacgaggtcttcgagaaacttcgccaaggcaccgtcgacggacgcatggccatc
cgctactaa

DBGET integrated database retrieval system