KEGG   Cryobacterium arcticum: PA27867_1060Help
Entry
PA27867_1060      CDS       T04435                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cart  Cryobacterium arcticum
Pathway
cart00010  Glycolysis / Gluconeogenesis
cart00030  Pentose phosphate pathway
cart00051  Fructose and mannose metabolism
cart00052  Galactose metabolism
cart00680  Methane metabolism
cart01100  Metabolic pathways
cart01110  Biosynthesis of secondary metabolites
cart01120  Microbial metabolism in diverse environments
cart01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cart00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA27867_1060
   00030 Pentose phosphate pathway
    PA27867_1060
   00051 Fructose and mannose metabolism
    PA27867_1060
   00052 Galactose metabolism
    PA27867_1060
  Energy metabolism
   00680 Methane metabolism
    PA27867_1060
Enzymes [BR:cart01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PA27867_1060
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PA27867_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ANP72026
UniProt: A0A1B1BHP3
LinkDB All DBs
Position
1:1212886..1213914
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGGRAYDSEFVGIRNGWRGLVQGEFMKLDRHSVRGL
SRQGGTILGSSRTNPFEGENAGPENIQKTMDAEGIDAIIAIGGEGTLTAARRLTDAGIKI
VGVPKTIDNDLAATDYSFGFNTAVEIATEAIDRLRTTADSHGRCMIVEVMGRHVGWIALH
SGMAGGAHAILIPEQPQTIEQICAWVESVRDRGRAPVLVVSEGFLLAEMGEAHSHKGLDA
FNRPRLGGISELIAPMVEERTGIEARATVLGHTQRGGAPSAYDRVLATRLGMAAVDAVVE
GKWGSMVSLKGTDINTVSIADATMDLNRVTQARYDEAAVLFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggtatcctcaccagcggtggagactgcccaggcctcaacgcagtgattcgg
ggtgctgttctcaagggaggccgcgcgtacgactccgagttcgtgggcatccgcaacggc
tggcgtgggctggtgcagggcgagttcatgaagctcgaccgtcacagcgtccgtggcctc
tcccgccagggtggcaccatcctcggcagctcccgcaccaacccgttcgagggcgagaac
gcgggcccggagaacatccagaagaccatggacgccgagggtatcgacgccatcatcgcc
atcggcggcgagggcaccctcaccgccgcccgccgtctcaccgacgccggcatcaagatc
gtcggcgtgccgaagaccatcgacaacgacctcgcggccaccgactactccttcggcttc
aacaccgccgtcgagatcgccaccgaggccatcgaccggctgcgcaccaccgccgactcg
cacggccgctgcatgatcgtcgaggtcatgggccgccacgtgggttggatcgccctgcac
tccggcatggccggcggcgcacacgccatcctcatccccgagcagccgcagaccatcgag
caaatctgcgcctgggtcgagagcgtccgcgaccgcggccgggcacccgtgctcgtcgtg
tccgagggcttcctgctcgccgagatgggcgaggcccactcgcacaagggcctggacgcg
ttcaaccgtccccgcctcggcggcatcagcgagctcatcgcccccatggtcgaagagcgc
accggtatcgaggcccgcgcgacggtcctcggccacacccagcgcggtggcgccccgtcg
gcctacgaccgcgtgctcgccacgcgtctcggcatggcggccgttgacgccgtcgtcgag
ggcaagtggggttcgatggtctccctcaagggaaccgacatcaacaccgtcagcatcgcc
gacgccaccatggacctcaaccgggtcacccaggcgcggtacgacgaagcagccgtgctc
ttcggctaa

DBGET integrated database retrieval system