KEGG   Candida auris: QG37_02057Help
Entry
QG37_02057        CDS       T04850                                 

Definition
(RefSeq) elongation factor mitochondrial precursor
  KO
K02358  
elongation factor Tu
Organism
caur  Candida auris
Brite
Translation factors [BR:caur03012]
 Eukaryotic Type
  Elongation factors
   QG37_02057
 Prokaryotic Type
   QG37_02057
Mitochondrial biogenesis [BR:caur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    QG37_02057
Exosome [BR:caur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   QG37_02057
  Exosomal proteins of breast cancer cells
   QG37_02057
  Exosomal proteins of colorectal cancer cells
   QG37_02057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 417 aa AA seqDB search
MRLGASLVAKSRPAIRSYAAFDRSKPHVNIGTIGHVDHGKTTLTAAITKVLSEKGGASFL
DYGSIDRAPEERARGITISTAHVEYQTDKRHYAHVDCPGHADYIKNMITGAAQMDGAIIV
VAASDGQMPQTREHLLLARQVGVQNLVVFVNKVDTIDDPEMLELVEMEMRELLTTYGFDG
DETPVIMGSALCALEGREPEIGEKAIMKLLDAVDEYIPTPQRDLEQPFLMPVEDVFSISG
RGTVVTGRVERGSLKKGEEIEIVGDFDKTFKATVTGIEMFKKELDAAMAGDNAGILLRGV
KRDEVSRGDVLAKPGTVSPHTKILASLYVLTKEEGGRHNPFGENYKPQLFLRTTNVTGTM
KFPEGEGVDHSAMVNPGDNVEMVIELGKKCPIELNQRFNLREGGKTVATGLVTRIIE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtctcggtgctagccttgtggctaagtcccgcccagctatcagaagctatgcagct
ttcgatcgttccaagccccacgtcaacattggtaccattggccatgttgaccacggtaag
actactttgactgctgccatcaccaaggttttgtcggagaaaggaggcgccagtttcttg
gactacggctcgattgacagagcccctgaggagagagccagaggtatcactatttccact
gcccacgttgagtaccagactgataagagacactatgcccacgtcgactgtccaggtcac
gctgattacatcaagaacatgattactggtgctgcccagatggatggtgctatcattgtt
gttgctgcttccgacggtcagatgcctcagaccagagagcaccttttgttggcaagacag
gttggtgttcagaacttggttgtattcgttaacaaggtcgacaccattgacgaccctgag
atgttggaattggttgagatggaaatgagagaattgttgaccacttacggtttcgacggt
gatgagactcctgtaatcatgggttctgctttgtgtgctttggaaggtagagagccagag
attggtgaaaaggcaatcatgaaattattggacgctgtcgacgagtacattccaacccca
cagcgtgacttggagcagccattcttgatgccagttgaagacgttttctccatttctggt
agaggtactgttgtcactggtagagttgaaagaggttccttgaagaagggtgaggaaatc
gagattgttggtgactttgacaagacttttaaggccactgtcactggtattgagatgttt
aagaaggaattagatgctgccatggctggtgacaacgctggtatcttgttgagaggtgtc
aagagagacgaagtgtctcgtggtgacgttttggctaagcccggaactgtttccccacac
accaagattttggcttccttgtatgttttgaccaaggaagaaggtggtcgtcacaacccc
ttcggtgaaaactacaagcctcaattgttccttagaaccaccaacgtcactggtaccatg
aagttcccagagggcgagggcgtggaccactccgctatggtcaacccaggtgacaacgtt
gaaatggtcattgaattgggtaagaagtgccccattgagttgaaccagcgtttcaacctt
agagagggtggtaagaccgttgccactgggttggtgaccagaattattgagtaa

DBGET integrated database retrieval system