KEGG   Candida auris: QG37_02283Help
Entry
QG37_02283        CDS       T04850                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
caur  Candida auris
Pathway
caur00250  Alanine, aspartate and glutamate metabolism
caur00410  beta-Alanine metabolism
caur00430  Taurine and hypotaurine metabolism
caur00650  Butanoate metabolism
caur01100  Metabolic pathways
caur01110  Biosynthesis of secondary metabolites
Module
caur_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:caur00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    QG37_02283
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    QG37_02283
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    QG37_02283
   00430 Taurine and hypotaurine metabolism
    QG37_02283
Enzymes [BR:caur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     QG37_02283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 28876066
NCBI-ProteinID: XP_018170476
UniProt: A0A0L0P319
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MTIKCDLEKNRVEELDELLSIIHPKIVLYVAQADPNSPEYRQESLGTYHEPQSLKKVFTS
NDTIFQKGLKNSRDELFQQIDNVLKYSVNTWNPGFLDKLYASTNPIGVISDIILSVLNTN
SHVYTVSPVLSVLENFMGKKYARLFWEKSSTAGGLTFSGGSWSNITAMHMARSLKFPETK
LEGNNGRKFAVFTSKHCHYSVEKAAILLGMGQKSVFKVDINKDGTLKPDALDLAIEAALK
DGFTPFFINATAGTTVFGSFDDLEAIGPIAKKYNLWLHVDGSWGGNVAFSKTHRQKVRGV
CNADSVTVNPHKMLGTPTTCSFLLVRDVRNFQTANSLSAPYLFHGRDNDEENHDLADGTM
GCGRRADSFKFYLSWLYYGEEGLKARVDHAFAIVDYFKKKISSVPGFELVVESPQCLQVC
FFYRPPGYDKQTLTDVTRYVSRELHKQGKYLVDFSPDTSKDTKGEFFRVVFNSPILTDKV
VDNLVENIVAIGKQYKANQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaagtgtgacctagaaaaaaacagagtcgaagaattggacgagctcctatcg
ataattcatcccaaaattgtgctgtacgtggctcaagccgacccaaactctccagagtac
aggcaagagtccttgggtacttaccacgagccgcagtcgttaaagaaagtgttcaccagc
aacgacaccatttttcaaaaaggattgaaaaattctagagatgagctttttcagcaaata
gacaatgtgttaaagtattccgtgaacacctggaaccctggctttttggataagttgtat
gcctcaactaatcctattggtgtgatcagtgatatcatcttgtcggtacttaacacgaac
tcccacgtatacactgtttcccctgttttgtcagtgctcgaaaacttcatgggaaaaaaa
tatgctcgactcttttgggagaagagttccactgctggtggcctcacattctctggaggt
tcgtggtccaacatcactgccatgcacatggccagatcgctcaagttccccgagacgaaa
ctcgaaggtaacaatggccgtaaatttgctgtgttcacctcgaagcattgccactactct
gtcgagaaggctgccattttgcttggaatgggccaaaagagtgtattcaaagtcgacata
aataaggatggcacgttgaagcccgacgcacttgatctggccattgaagctgctttgaaa
gacgggtttacgccgttttttatcaacgccactgcaggtacgaccgttttcgggtcattt
gatgatttggaggcgattggtcccattgccaaaaagtacaacttgtggttgcatgtggat
ggttcatggggaggcaatgtagctttctcgaaaacgcaccgccaaaaagtccgtggagta
tgtaacgctgactccgtgaccgttaacccacacaagatgttgggaacgcccaccacttgc
tcctttctactcgtacgagacgtgcggaacttccagactgcaaattctctcagcgcccca
tacttgtttcatggaagggacaacgacgaagagaaccatgatttagcagacggaaccatg
ggatgcggcagaagggcagattcgttcaaattctacctatcttggttgtactatggagaa
gaaggcttgaaggctcgagtggaccatgcgtttgccattgtggactacttcaaaaaaaag
atatcaagcgttccaggattcgagttggtggttgaatcgcctcagtgcttgcaggtatgc
tttttctaccgtccgccaggttacgacaaacagactttgacagatgtcacccgatatgtc
tcgcgagagcttcacaagcaaggcaagtaccttgttgatttttcaccagacacgtctaaa
gacaccaagggagagtttttcagggttgtgttcaactcacccatcctcacggacaaggtt
gtggacaatttggtggagaacattgttgctatcgggaagcaatacaaggcgaaccaatag

DBGET integrated database retrieval system