KEGG   Corynebacterium atypicum: CATYP_07025Help
Entry
CATYP_07025       CDS       T03227                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cax  Corynebacterium atypicum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cax00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CATYP_07025
   00650 Butanoate metabolism
    CATYP_07025
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CATYP_07025
   00280 Valine, leucine and isoleucine degradation
    CATYP_07025
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CATYP_07025
Enzymes [BR:cax01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CATYP_07025
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CATYP_07025
Amino acid related enzymes [BR:cax01007]
 Aminotransferase (transaminase)
  Class III
   CATYP_07025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1540043..1541371
Genome map
AA seq 442 aa AA seqDB search
MQDFTYPIEQTRRIDPDASPGPSSQELGRRLKKATPRAVTPNMECFINAASGGILRDTDG
NRFIDLASGIAVTSVGASHPKVVAAVQDAVSRFTHTSFMISPYESYVAVAEKLNQITPGE
HEKTTALFNSGAEAVENAIKIARAATGKKAVVAFDNAFHGRTNLTMALTAKAHPYKSGFG
PFADEVYRMPTSYPLRDALTGKQAAERAIRGIDKHVGAENLAALIIEPIPGEGGFIVPAE
GYLNELESWARENGVIFIADEIQSGLARTGRWFASDWFGITPDIITTAKGIAGGMPLSAV
TGRAEIMDACAPGSLGGTYGGNPVACAAALAALSAMEEEGLAARALEIEEVIRQELAAIP
EGIAEIRGHGAMMAIEIVDAAGAPDPARTSAIAAACKKAGVLVLTCGLDGNVVRLLPPLV
INQATLKDGLGVLVQAFAQTRP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggacttcacctaccctattgagcagacccgcaggatcgaccccgacgcaagcccc
gggcccagcagccaggagctgggacggcggctcaaaaaggcaacgccgcgcgcggtcacg
ccaaacatggagtgtttcatcaacgccgccagcggcgggattctgcgcgatacagacgga
aaccgcttcatcgacctcgcctcggggatcgccgttacctcagtcggggcctcgcacccg
aaggtggtggccgcggtgcaggacgccgtgagtcgctttacccacaccagcttcatgatc
agcccctacgagtcttacgtcgccgtggccgaaaagctcaaccagatcaccccaggcgag
cacgagaaaacgacggcgctgttcaactcgggcgcggaggccgtagaaaacgcgatcaaa
atcgcacgcgctgctaccggcaaaaaggccgtggtcgccttcgacaacgccttccacggc
cgcaccaacctcacgatggcgctcacggcaaaggcccacccgtacaagtccggcttcggc
cccttcgccgacgaggtctaccggatgcccacgtcctatcccctacgcgacgcgctcacc
ggaaagcaggcagccgagcgcgccattcgcggcatcgacaagcacgtaggcgccgagaac
ctcgccgcactgatcatcgagcccatccccggcgaaggcggcttcatcgttcccgccgag
ggctacctcaacgagctcgagagctgggctcgcgaaaacggcgtcatctttatcgccgac
gagatccaatccgggctcgcgcgcaccggccggtggttcgcctccgattggttcggcatc
acccccgacatcatcaccaccgccaagggcatcgccggcgggatgccgctttccgcggtg
accgggcgcgcggagatcatggatgcttgcgccccaggcagcctgggcggcacctacggc
ggcaacccggtagcctgcgccgccgcgctcgccgcgttgagcgcgatggaagaggaaggt
ttggccgcccgcgcgctagagatcgaagaggtcatccgccaagagctggcggcgatcccc
gaaggcatcgcagagattcgcggccacggagccatgatggccatcgagattgtcgacgcc
gcgggcgccccggatcccgcgcgcacttcagccatcgccgcggcctgcaaaaaggccggc
gttctggtgctcacctgcgggctagacggcaacgtcgtccggctgttgccgccgctggtg
atcaaccaggcaacgctgaaagacggcctcggcgtcctcgtccaggccttcgcccagacc
aggccctaa

DBGET integrated database retrieval system