KEGG   Clostridium botulinum A ATCC 19397: CLB_2236Help
Entry
CLB_2236          CDS       T00574                                 

Gene name
tgl
Definition
(GenBank) protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
cba  Clostridium botulinum A ATCC 19397
Brite
Enzymes [BR:cba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     CLB_2236 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2375366..2376187)
Genome map
AA seq 273 aa AA seqDB search
MIKISGNTVTRDKIVAKYPPNSLERKIAEQLSSNQDVHNYDSLNQLEFDIKLRANIVESA
RELDRSDLSFTTFRRSRCNRDYWQRTDEGGFLLKEYVKASDAIKDIFINTSKYGTECATA
IVIIYYKALLNVLPEQLFNEMFPSIYLFDWQYLDRNLHVESYGGVTEFFPGDCQYFKNPD
VNPATPEWQGENVINLGNGTYYGHGIGITSANGIIRELNRNRRRGATESAFLTDSVTRLN
SKEIFDKYYNFSSTMRIKRSREIHRGYPNYLYY
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatttcaggtaatacagttaccagagataaaattgttgctaagtatccaccc
aatagcctggaaagaaagattgccgagcagttatcatcaaatcaagatgttcataactat
gactcgctaaatcaattagagtttgacataaaactaagagcaaatattgttgagtcagcc
agggaattagatagaagcgatttgagttttacaacctttcgtagatccagatgtaataga
gattactggcagcgtactgatgaaggtggctttttattaaaagaatatgtaaaggcatct
gatgccataaaggatatctttattaatacttcaaaatatggtactgaatgtgccactgca
atagttattatttattataaggcacttcttaacgtacttccagaacaactttttaatgaa
atgtttccaagcatatatttattcgactggcaatatctagatagaaaccttcatgtggaa
tcatatggaggtgtaacagagttctttcctggagattgtcaatattttaaaaatcctgat
gtaaacccggcaacgcctgaatggcagggggaaaatgttattaatttaggtaatggaact
tattatggtcatggtataggtataacaagcgctaatggaataataagagaattaaatagg
aacagaagaaggggagctacagaatcagcttttttaacagattctgtaacgcgtttaaat
tctaaggaaatatttgataaatattataattttagttctacaatgcgaataaagaggagt
agagagattcatagaggctatccaaattatttatattattaa

DBGET integrated database retrieval system