KEGG   Comamonadaceae bacterium A1: SRAA_2131Help
Entry
SRAA_2131         CDS       T03614                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cbaa  Comamonadaceae bacterium A1
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SRAA_2131
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SRAA_2131
Enzymes [BR:cbaa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SRAA_2131
Peptidoglycan biosynthesis and degradation proteins [BR:cbaa01011]
 Precursor biosynthesis
  Racemase
   SRAA_2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2292916..2294085
Genome map
AA seq 389 aa AA seqDB search
MPRPIHATVHLPALQHNLQRCRQAGGAARVWAVLKANAYGHGIERVYAALRGADGLALLD
LSEAERLRALGWRGPILLLEGAFEPRDLELCSRLQLWHVLHRSEQIDWLAAHKTEAPQRV
FLKLNSGMNRLGLRPEAFRAAWTRLSHLPQVEEIGLMTHFSDADGLRGGQEGVRHQLDTF
VRTTHDLPGERSLCNSAALLRHGLALHLGSGPEAQPLAADWTRPGIALYGSAPDFAQHSA
ADWGLQPSLTLASQLIAVQDVPAGETVGYGSTYTATHAMRIGIVACGYADGYPRHAPGSN
AHGGPVLVRGVRTRLVGRVSMDMLAVDLGPVEAHLGSTCKPGDAVTLWGRSGCGALLPID
EVAQAAGTLGYELMCALAARVPVSVEPLP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccacgccccatccacgccaccgtccacctgcctgcgctgcaacacaacctgcagcgc
tgccgccaagccggcggcgcggcgcgggtgtgggcggtgctcaaggccaacgcctacggc
cacggcatcgagcgcgtctatgccgcgctgcgcggcgccgacgggctggcgctgctggac
ctgagcgaggccgaacggctgcgcgccctgggctggcgcggccccattttgctgctcgaa
ggcgcgttcgagccgcgcgacctggagctctgctcgcggctgcaactctggcacgtgctg
caccgcagcgagcagatcgactggctggcggcgcacaagaccgaagcgccgcagcgcgtg
ttcctcaagctcaactccggcatgaaccggctcggcctgcgccccgaggcctttcgcgcc
gcctggacgcgcctgagccacctgccccaagtcgaagaaatcggcctgatgacgcacttc
agcgacgccgacggcctgcgcggcggccaagaaggtgtgcggcaccagctcgacaccttt
gtgcgcaccacccacgacctgcccggcgagcgcagcctgtgcaacagcgccgccctgctg
cgccacgggctggcgctgcacctgggcagcggccccgaagcgcagccgctggcggccgac
tggacccgccccggcatcgcgctctacggcagcgcgcccgactttgcgcagcacagcgcc
gccgactggggcttgcagcccagcctgacgctggccagccaactgatcgcggtgcaagac
gtgcctgcgggcgaaaccgtgggctacggctccacctacaccgccacccacgccatgcgc
attggcatcgtggcctgcggctatgccgacggttacccgcgccacgcccccggcagcaac
gcccacggcggcccggtgctggtgcgcggcgtgcgcacgcgcctggtcgggcgcgtgagc
atggacatgctggccgtcgatctgggcccggtcgaggcgcacctgggcagcacctgcaag
cccggcgacgcagtcacgctctggggccgcagcggctgcggcgcactgctgcccatcgac
gaagtggcgcaggccgctggcaccttgggctacgaactgatgtgtgcgctggccgccagg
gtgccggtatcggtcgagccgctgccctga

DBGET integrated database retrieval system