KEGG   Coriobacteriaceae bacterium 68-1-3: JI75_08805Help
Entry
JI75_08805        CDS       T03545                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cbac  Coriobacteriaceae bacterium 68-1-3
Pathway
cbac00473  D-Alanine metabolism
cbac00550  Peptidoglycan biosynthesis
cbac01100  Metabolic pathways
cbac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbac00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    JI75_08805
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JI75_08805
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    JI75_08805
Enzymes [BR:cbac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JI75_08805
Peptidoglycan biosynthesis and degradation proteins [BR:cbac01011]
 Precursor biosynthesis
  Amino acid ligase
   JI75_08805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST GARS_A ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AJC12732
UniProt: A0A0A8BC37
LinkDB All DBs
Position
complement(1958767..1959705)
Genome map
AA seq 312 aa AA seqDB search
MNPENCKVALLYGGTSGERSISIASGEGSKAALIEAGYQVTMIDTAEKAQIMRLFSEEFD
VAFLCLHGKMGEDGTVQGLLEYAGIPYTGSGVLSSALSMDKAKAKVMYEAAGLPTPPSIY
LERGKSYAIDEIVQKLGVPCVVKPATEGSALGVFIVEREADLKPRIEEAFAIDDHLVVEK
YIKGVELTAAVLGNEDVEALPVIEIVPSHEFYDFESKYAPGGSQHICPARLSDGDTARVQ
QLAIDAHKVLGCRGVSRTDMIRDAEGDIWLLETNTIPGMTSTSLLPDAARAVGLDFPRLC
SKLVELALEGRR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgaaaactgcaaggtagctcttttgtatgggggtacgagcggagagcgctcg
atctcgatcgcttccggggagggatccaaagcggcgctcatcgaggcgggataccaggtc
acgatgatcgatacggccgagaaggctcagatcatgaggctcttctcggaggagttcgat
gtcgcgttcctctgccttcacgggaaaatgggagaagacggcacggtccagggtttgctg
gaatacgccggaattccctataccggttcgggcgtgctgtccagcgcgctttccatggac
aaggccaaagcgaaggtcatgtacgaggcagccggtctgcccaccccgccgtctatctac
ctcgagcgcgggaaatcgtacgcgatcgatgaaatcgtgcagaagctcggcgtgccctgc
gtggtgaaacccgcaaccgaagggagcgccctgggtgttttcatagtcgagcgggaagcc
gacctcaagcctcggatcgaggaggcgttcgcgatcgacgaccatctcgtggtggagaag
tacatcaagggcgtcgagctgaccgccgcggtgttgggaaacgaagacgtcgaggcgctg
ccggtgatcgagatcgtcccctcgcacgagttctacgatttcgaatccaaatacgctcca
ggtgggtctcagcatatctgcccggcgcggctctccgatggggatacggcgcgtgtgcag
cagctcgccatcgatgctcataaggtcctcggctgccgcggggtttcccgcacggatatg
atccgggatgcggagggggatatctggctgctggaaaccaatacgatccccggtatgacc
agcacgtccctgcttcccgacgccgcgcgcgccgtcgggttggactttccccggctgtgc
tcgaagttggtggagctggcgctcgaggggcgccgctga

DBGET integrated database retrieval system