KEGG   Cellulophaga baltica NN016038: M667_18575Help
Entry
M667_18575        CDS       T03562                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cbal  Cellulophaga baltica NN016038
Brite
Enzymes [BR:cbal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M667_18575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: AIY15007
LinkDB All DBs
Position
4250627..4251226
Genome map
AA seq 199 aa AA seqDB search
MKKIIGTLALVAISLSYSCKDTKKEVKDTSDEIENSADDKSSEMDNTMEEKTMTISLEPK
SDSEVKGEVTFTEKEGEVMMVATLAGLSEGEHAIHIHETADCSSADGKSAGGHWNPTFQQ
HGKWGDEAGYHRGDIGNFMADAEGNATVEFSTDEWCMDCDDDTKNIIGKGVIVHQGVDDF
TSQPSGDAGARVSCAGIIQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataggcaccctagcacttgttgccataagtttatcttatagctgcaag
gacacaaaaaaggaagttaaggatacttctgatgaaatagaaaatagcgcggatgacaag
tctagtgagatggataataccatggaagaaaaaaccatgaccatttctttagaacctaaa
agtgattctgaagttaaaggcgaagttacttttaccgaaaaagagggcgaagtcatgatg
gtggctacattagctggattatctgagggagaacatgctattcatattcacgaaacggca
gattgttcttctgctgatggaaaatctgcgggtggccattggaacccaacattccaacaa
cacggaaaatggggtgatgaagctggatatcacagaggtgatatcggaaactttatggca
gatgcagaaggtaatgctacagtagaattcagcactgacgaatggtgtatggattgtgat
gatgataccaagaacattattggtaaaggagtaattgttcaccaaggagtagatgatttt
acgtctcaacctagtggagacgcaggcgctcgtgttagttgtgccggtataattcaataa

DBGET integrated database retrieval system