KEGG   Coxiella burnetii CbuK_Q154: CbuK_0035Help
Entry
CbuK_0035         CDS       T00788                                 

Definition
(GenBank) acyl-CoA synthetase
Organism
cbc  Coxiella burnetii CbuK_Q154
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
32951..35761
Genome map
AA seq 936 aa AA seqDB search
MDKSLTEIESQVISLTHQFLLESGAERAARAVSLDARLEHDLGIGSLEKAELFSRIEKSL
GVELPESLLVKAKQLNDVVKAVKMAEPTLLKVKREVIAPLKSTRTDPSKVETLVELLNLY
AQNEPDRPHIYFQNEFGEETIIRYGELYTRAKEFAQGLVGKGLKPSETVAIMLPTSADFF
YSFLGTLMAGGIPVPIYPPFRADQIEEYAKREAFILHNAGVRFLITFKRAAALSKLLQSF
VPSLLEVTTVKALTDISADLPTLDIEATDPVLIQYTSGSTGNPKGVLLNHANLLANISAY
GKTLNMQSTDAFVSWLPLYHDMGLIGAWMGSFYHGLPLTLLSPFTFLSRPEKWLWAIHYH
RGTISPGPNFAYDLCVKKIEDSALEGLDLSSWRVALNGSEMIHPDTLRNFEKRFRKYGFK
KEAIFPAYGLAECAFGLTFPPLNRGPNIDRIERLPYEKNNTAVPLTTRDKKYYEFVSCGS
VLEGHEIRIVDDNDNRVAERTIGNIQFKGPSAMQGYYGNSEATMAIYHNGWWATGDLGYL
AEGELFITGRKKDLIIKAGRNYHPTEIEAMASLAEGVRKGYVAAFGVADEKRGTEKLIIV
AETKEDKKIHPEIKKEIVDKVISQIGIPPDEILLVPPHTLPKTSSGKLRRSSCKQDYLAG
KLSRPSRSAFWQTIKLFIKSRAKKIEKWLINLIKVVFSFYVLILLFFTLLPVWLLFIILP
RKKAAAAFRFWARSIFRLIFSPISIKGKENISGQPMIYVANHGSFIDSVILAGVLPADTN
FIGKKELLKTPVIKSFVKQLDLVTVDRMDFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSY
ATGVRPFKLGAFKIAAELGKPICPVAIVGARKILRANQFLVRPAKLEVIICKPLIPESKE
WEEVMRLRKQSRLLIAKYSGEHVLDLVSAGVLSESE
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatcattaacggaaatcgaatcgcaagttatttccctcacccatcaatttctg
ttggagtctggcgctgaacgcgccgcccgcgccgtttctctcgatgcacggttagagcac
gatttggggataggcagtctagaaaaagcagaattatttagccgcattgaaaaatcatta
ggtgtcgaattacccgaatctcttctcgtaaaagccaagcaattaaacgatgttgttaaa
gccgtaaaaatggctgaacccactttgctcaaagtgaaaagggaagtcatcgcaccgctt
aaaagcactcgcaccgatccttctaaagtcgaaacgttagtcgaactcctcaacctctat
gctcaaaatgagcctgatcgtccgcacatttattttcaaaatgaattcggcgaagaaacc
attattcgttacggcgaactttatacgagagcaaaagaattcgcccagggtttagttgga
aaagggttaaaacccagtgaaaccgttgccattatgcttcccacgtcggccgattttttt
tattcatttttaggcacattgatggccggcggaatccctgttcctatttatccccccttt
cgtgctgatcaaattgaagaatatgccaagcgcgaagcttttatattgcataacgccggc
gttcgattcttaatcacgttcaaacgcgccgctgcactaagtaaattacttcaatcgttt
gttcctagcctattagaagtgactaccgtcaaagcattaacggatatatcagcggattta
cccacattagatattgaagctacagatcctgtgttaatccaatatacctctgggagcacg
gggaatccaaaaggggtattgctgaatcatgctaatttattagcgaatataagcgcctat
ggaaaaacgctcaacatgcagtcaacggatgcgttcgtcagttggcttccgctttaccat
gatatgggtttgatcggcgcttggatgggaagcttttaccatgggttaccgttaacttta
ctttctcctttcacttttttatcccgtcctgaaaaatggttatgggcgattcattatcac
cgagggactatatctcccggtcctaatttcgcttacgacctgtgcgtaaaaaaaattgaa
gatagcgctcttgagggcttggatttaagttcttggcgagtagctctaaatggatcggaa
atgattcatcctgacaccttgcgtaattttgaaaaacgattcagaaaatatggatttaaa
aaagaagcgatttttcccgcttacggccttgcagaatgtgcttttgggctcacttttcct
cctttaaatcgggggccgaatatcgatcgaatcgagcgattgccttatgaaaaaaacaat
accgccgtaccgttaaccacgcgcgataagaaatattatgaattcgtttcgtgcggcagt
gttttagaaggacacgaaatccgtattgtggacgataacgataatcgggttgctgaacgt
acgattggaaatatccagtttaaaggcccctccgccatgcaaggttattacggtaactca
gaagcaacgatggcgatttatcataatggttggtgggcgacgggagaccttggatattta
gccgaaggagagctttttattactggtcggaagaaagatttaattattaaggccggtcgt
aattatcatcccacagaaatcgaagcaatggctagcctcgctgagggagttcgaaaaggt
tatgtggctgcttttggggtagctgatgaaaaaagagggacggaaaaattaataatagtc
gccgaaacgaaagaagataaaaaaattcatcctgaaataaaaaaagaaatagtagataaa
gtgatttcacaaatcggcatcccgcctgacgaaattttattagtgcctccgcacaccttg
ccgaaaacatccagtggaaaattgcgtcgttcgagttgtaagcaagattatttggccgga
aaattaagtcgaccaagccggtctgctttttggcaaacgataaaattatttattaaaagt
cgtgcgaaaaaaatagaaaaatggttaattaatttgattaaagtggtatttagtttttat
gttctcattttattgtttttcaccttattacctgtttggttgttattcattattctgcct
cgaaaaaaagcagccgccgcttttcggttttgggcgcgttcaatttttcggctcatattt
tctcccatttctattaaaggaaaagaaaatattagcggacaaccgatgatttatgtcgct
aatcatggcagttttatagatagcgtgatacttgctggtgtattgccggccgacaccaat
tttatcggtaaaaaagaattgttaaaaacacccgtcataaaaagcttcgtcaagcaactt
gacctcgtcacggttgatcgcatggatttttcaaaaagccattctgatgtgaaacgaatt
gagcagacattggaacaaggccgttccgtccttatttttcctgaagggacgtttagttat
gcaactggcgtacgaccctttaagctcggtgcttttaaaatcgcagccgaactagggaaa
cccatttgcccggttgctattgttggcgctagaaaaattttgcgcgcgaatcaattctta
gtaagaccagcgaaattggaagtcattatttgtaaacccttaatccctgagagtaaggaa
tgggaggaggttatgcggttacgcaaacaatcccgccttttaattgcgaaatacagcggt
gagcacgttctagatttggtttcagcgggagtgctaagtgaatcagagtaa

DBGET integrated database retrieval system