KEGG   Coxiella burnetii CbuK_Q154: CbuK_0118Help
Entry
CbuK_0118         CDS       T00788                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cbc  Coxiella burnetii CbuK_Q154
Brite
Enzymes [BR:cbc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CbuK_0118 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACJ19439
LinkDB All DBs
Position
complement(111025..111615)
Genome map
AA seq 196 aa AA seqDB search
MRGNILRCVEGILAIIIFDENEKGVFMLSRISLLIVVLFSLFYFSLANAETVAVNMYRVA
KTGHGSSVGSVTLTDTQYGLLIKPNLRGLPPGRIHGLHIHLNPDCSNKGEAAGGHLDPAN
TGKHLGPYNPNGHLGDLPALTVEKNGTATLPILAPRLKVKNLIGHSLMIHAGGDNYSDHP
KELGGGGARIACGIVK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaaatattttgaggtgcgtcgaggggattcttgctataatcattttcgatgaa
aacgaaaaaggagtttttatgctatcaagaattagtctattaatcgtagttttgttctct
ttattttatttctctttggcgaatgcagaaacggttgcggtaaatatgtatcgcgttgca
aaaacggggcatgggtcttcggtaggttcggtaaccttgacggatactcaatatggtttg
ttaataaaacccaatttgcgaggcttaccgccggggagaattcatgggctccacattcac
ctgaaccctgattgcagtaacaagggcgaagcagcgggcggtcatttagatccggcgaac
acaggtaaacatttaggtccctacaatcccaatggccatttgggcgatttaccggcttta
acggtggaaaaaaatggaacagcgaccctgcctattttagcgccacgcctgaaagtgaaa
aacctcatcggccattcattaatgatccacgcgggtggtgataattattccgatcatccg
aaagaactgggcggcggtggtgcgcgaattgcgtgtgggattgttaaatag

DBGET integrated database retrieval system