KEGG   Coxiella burnetii CbuK_Q154: CbuK_0304Help
Entry
CbuK_0304         CDS       T00788                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbc  Coxiella burnetii CbuK_Q154
Brite
Enzymes [BR:cbc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CbuK_0304 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(278172..278753)
Genome map
AA seq 193 aa AA seqDB search
MAFELPDLPYKLNALEPHISQETLEYHHGKHHRAYVNKLNKLIEGTPFEKEPLEEIIRKS
DGGIFNNAAQHWNHTFYWHCMSPDGGGDPSGELASAIDKTFGSLEKFKALFTDSANNHFG
SGWAWLVKDNNGKLEVLSTVNARNPMTEGKKPLMTCDVWEHAYYIDTRNDRPKYVNNFWQ
VVNWDFVMKNFKS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccggatttgccctacaaactcaacgcactggaaccgcatatctct
caagaaacgctcgaatatcaccacggaaaacaccatagagcttatgtcaataaactcaac
aaacttatcgaaggcaccccttttgaaaaggaacctctggaagaaattattcgaaaatcc
gacggcggaatcttcaacaatgcagcacaacattggaaccatacattttattggcactgc
atgagccctgatggcggtggagatccttctggcgaattggcttcagctattgataaaact
tttggatctttagagaaatttaaagcgctttttaccgactccgcaaataatcatttcggc
tcgggatgggcttggctcgttaaagataacaatggcaaattagaagtcttaagcactgtc
aacgctcgtaatcccatgactgaaggcaaaaaacccctaatgacttgtgatgtttgggaa
cacgcctattacatcgatacccggaacgaccgccccaaatacgttaataacttttggcaa
gtggtcaattgggattttgtgatgaaaaacttcaaatcctaa

DBGET integrated database retrieval system