KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_0194Help
Entry
CBUD_0194         CDS       T00583                                 

Definition
(GenBank) acyl-CoA synthetase
Organism
cbd  Coxiella burnetii Dugway 5J108-111
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(176009..178819)
Genome map
AA seq 936 aa AA seqDB search
MDKSLTEIESQVISLTHQFLLESGAERAARAVSLDARLEHDLGIGSLEKAELFSRIEKSL
GVELPESLLVKAKQLNDVVKAVKMAEPTLLKVKREVIAPLKSTRTDPSKVETLVELLNLY
AQNEPDRPHIYFQNEFGEETIIRYGELYTRAKEFAQGLVGKGLKPSETVAIMLPTSADFF
YSFLGTLMAGGIPVPIYPPFRADQIEEYAKREAFILHNAGVRFLITFKRAAALSKLLQSF
VPSLLEVTTVKALTDISADLPTLDIEATDPVLIQYTSGSTGNPKGVLLNHANLLANISAY
GKTLNMQSTDAFVSWLPLYHDMGLIGAWMGSFYHGLPLTLLSPFTFLSRPEKWLWAIHYH
RGTISPGPNFAYDLCVKKIEDSALEGLDLSSWRVALNGSEMIHPDTLRNFEKRFRKYGFK
KEAIFPAYGLAECALGLTFPPLNRGPNIDRIERLPYEKNNTAVPLTTRDKKYYEFVSCGS
VLEGHEIRIVDDNDNRVAERTIGNIQFKGPSAMQGYYRNSEATMAIYHNGWWATGDLGYL
AEGELFITGRKKDLIIKAGRNYHPTEIEAMASLAEGVRKGCVAAFGVADEKRGTEKLIIV
AETKEDKKIHPEIKKEIVDKVISQIGIPPDEILLVPPHTLPKTSSGKLRRSSCKQDYLAG
KLSRPSRSAFWQTIKLFIKSRAKKIEKWLINLIKVVFSFYVLILLFFTLLPVWLLVIILP
RKKAAAAFRFWARSIFRLIFSPISIKGKENISGQPMIYVVNHGSFIDSVILAGVLPADTN
FIGKKELLKTPVIKSFVKQLDLVTVDRMDFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSY
ATGVRPFKLGAFKIAAELGKPICPVAIVGARKILRANQFLVRPAKLEVIICKPLIPESKE
WEEVMRLRKQSRLLIAKYSGEHVLDLVSAGVLSESE
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatcattaacggaaatcgaatcgcaagttatttccctcacccatcaatttctg
ttggagtctggcgctgaacgcgccgcccgcgccgtttctctcgatgcacggttagagcac
gatttggggataggcagtctagaaaaagcagaattatttagccgcattgaaaaatcatta
ggtgtcgaattacccgaatctcttctcgtaaaagccaagcaattaaacgatgttgttaaa
gccgtaaaaatggctgaacccactttgctcaaagtgaaaagggaagtcatcgcaccgctt
aaaagcactcgcaccgatccttctaaagtcgaaacgttagtcgaactcctcaacctctat
gctcaaaatgagcctgatcgtccgcacatttattttcaaaatgaattcggcgaagaaacc
attattcgttacggcgaactttatacgagagcaaaagaattcgcccagggtttagttgga
aaagggttaaaacccagtgaaaccgttgccattatgcttcccacgtcggccgattttttt
tattcatttttgggcacattgatggccggcggaatccctgttcctatttatccccccttt
cgtgctgatcaaattgaagaatatgccaagcgcgaagcctttatattgcataacgccggc
gttcgattcttaatcacgttcaaacgcgccgctgcactaagtaaattacttcaatcgttt
gttcctagcctattagaagtgactaccgtcaaagcattaacggatatatcagcggattta
cccacattagatattgaagctacagatcctgtgttaatccaatatacctctgggagcacg
gggaatccaaaaggggtattgctgaatcatgctaatttattagcgaatataagcgcctat
ggaaaaacgctcaacatgcagtcaacggatgcgttcgtcagttggcttccgctttaccat
gatatgggtttgatcggcgcttggatgggaagcttttaccatgggttaccgttaacttta
ctttctcctttcacttttttatcccgtcctgaaaaatggttatgggcgattcattatcac
cgagggactatatctcccggtcctaatttcgcttacgacctgtgcgtaaaaaaaattgaa
gatagcgctcttgagggcttggatttaagttcttggcgagtagctctaaatggatcggaa
atgattcatcctgacaccttgcgtaattttgaaaaacgattcaggaaatatggatttaaa
aaagaagcgatttttcccgcttacggccttgcagaatgtgctttggggctcacttttcct
cctttaaatcgggggccgaatatcgatcgaatcgagcgattgccttatgaaaaaaacaat
accgccgtaccgttaaccacgcgcgataagaaatattatgaattcgtttcgtgcggcagt
gttttagaaggacacgaaatccgtattgtggacgataacgataatcgggttgctgaacgt
acgattggaaatatccagtttaaaggcccctccgccatgcaaggttattaccgtaactca
gaagcaacgatggcgatttatcataatggttggtgggcgacgggagaccttggatattta
gccgaaggagagctttttattactggtcggaagaaagatttaattattaaggccggtcgt
aattatcatcccacagaaatcgaagcaatggctagcctcgctgagggagttcgaaaaggt
tgtgtggctgcttttggggtagctgatgaaaaaagagggacggaaaaattaataatagtc
gccgaaacgaaagaagataaaaaaattcatcctgaaataaaaaaagaaatagtagataaa
gtgatttcacaaatcggcatcccgcctgacgaaattttattagtgcctccgcacaccttg
ccgaaaacatccagtggaaaattgcgtcgttcgagttgtaagcaagattatttggccgga
aaattaagtcgaccaagccggtctgctttttggcaaacgataaaattatttattaaaagt
cgtgcgaaaaaaatagaaaaatggttaattaatttgattaaagtggtatttagtttttat
gttctcattttattgtttttcaccttattacctgtttggttgttagtcattattctgcct
cgaaaaaaagcagccgccgcttttcggttttgggcgcgttcaatttttcggctcatattt
tctcccatttctattaaaggaaaagaaaatattagcggacaaccgatgatttatgtcgtt
aatcatggcagttttatagatagcgtgatacttgctggtgtattgccggccgacaccaat
tttatcggtaaaaaagaattgttaaaaacacccgtcataaaaagcttcgtcaagcaactt
gacctcgtcacggttgatcgcatggatttttcaaaaagccattctgatgtgaaacgaatt
gagcagacattggaacaaggccgttccgtccttatttttcctgaagggacgtttagttat
gcaactggcgtacgaccctttaagctcggtgcttttaaaatcgcagccgaactagggaaa
cccatttgcccggttgctattgttggcgctagaaaaattttgcgcgcgaatcaattctta
gtaagaccagcgaaattggaagtcattatttgtaaacccttaatccctgagagtaaggaa
tgggaggaggttatgcggttacgcaaacaatcccgccttttaattgcgaaatacagcggt
gagcacgttctagatttggtttcagcgggagtgctaagtgaatcagagtaa

DBGET integrated database retrieval system