KEGG   Clostridium beijerinckii NCIMB 14988: LF65_01673Help
Entry
LF65_01673        CDS       T04773                                 

Definition
(GenBank) hypothetical protein
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cbei00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LF65_01673
Enzymes [BR:cbei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LF65_01673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1877781..1879811
Genome map
AA seq 676 aa AA seqDB search
MYFGADYYPEHWPRAEWESNALLMKEASINVVRIAEFAWAKMEPKEGVFDFSWLDEVIEV
LSKQGIKVILGTPTATPPKWLSDKIEDIYMVNEFNQVRGFGSRRHYCYNNSKYKEYTAKI
VTALAKHYKNNTNVVAWQIDNEFGCHDTVRCYCNNCLKDFQGWLENKYKSIERLNEEWGT
VFWSQTYSSFEEIILPKYTVCDSAVSASGLNGRKRYSHNPGLLLDFYRFSSDSVVKYQKL
QIDIIKNCDCNQPINNNLMGHFNQIDYFKLGEDLDFVSWDNYPNNEWGQNSMFSVSMAHD
LMRGVKGKKFWMMEQQSGPCGWNSLGDTPKPGQIRLWTYQAIAHGAEGIVFFRWRACPFG
TEQYWYGILDHDGIPRRRYKEIKQIGSEVERLSDLFVDSKVLSEAAIIKSYDNLWSHQFQ
PHNEKFDYNSLLIQYYTALGTNNINSDIVPYNIDFSEYKLLIMPAFNLMKDDILQRVENY
VSGGGNLVLTFRSGTKEWNNSMTIKTLPGYFKELAGVTVEEFDSINFGREVQMFTEYGMG
KVLMWADILKPISAEIIGTYASDFYEGEAAITVNSYGKGKVYYIGCDLEQEVLNKLLEEI
ALKSGIKPLIPNNIEGVEVVSKEKNGRKYIIVMNHNGYEVEIHLSGTYKELISNIDIDGK
LMLNPYEVAILETNVG
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggagcagattattatccagaacattggccaagagcagaatgggaaagtaat
gcattattgatgaaagaagcaagtattaatgtagtaagaattgctgaatttgcttgggca
aagatggaacctaaagaaggcgtgtttgatttttcgtggttagatgaggttattgaggtg
ctttctaaacaaggaataaaggtgattttaggtacgcctactgctactcctcctaaatgg
ctttcggataagattgaagatatctatatggtaaatgagtttaatcaggttaggggattt
ggtagtagaaggcattattgttacaataattcaaaatataaagaatacacagcaaagatt
gtaactgctttagcaaagcattataaaaataatacaaatgtagttgcatggcaaattgat
aatgagtttggatgccatgatacagtgagatgttattgcaataattgtcttaaagatttt
caaggttggctagaaaacaaatataaatcaattgaaagacttaatgaagaatggggaaca
gttttttggagtcaaacttatagcagttttgaagaaattattcttcctaaatatactgtt
tgtgattcagctgtgagtgcatcaggtttaaatggtagaaaaagatactcacataaccca
gggctattacttgacttttatagattttcttctgattctgtagttaaatatcaaaaatta
caaatagatataattaaaaattgtgattgcaatcagccaataaataataatttgatggga
cattttaatcaaatagattattttaaattaggagaagatttagattttgtatcttgggat
aactatcctaacaatgaatggggtcagaattctatgttttcagtttcaatggcgcatgat
cttatgaggggtgtaaagggaaaaaagttttggatgatggagcagcaaagtggtccttgt
ggatggaattctcttggagatacacctaaacctgggcaaataagactttggacatatcaa
gcgatagctcatggagcggaaggaatcgtttttttcaggtggagagcttgtccttttggt
actgagcaatattggtatggaattctagatcatgatggaattccgagacgcagatataaa
gagataaagcagataggaagtgaagttgaaagactttcagatttatttgtggattctaaa
gtattatcagaagcggcgattataaaatcttatgataatctttggagtcatcaattccaa
ccccacaatgaaaagtttgattataattctttattaattcaatactatacagctttggga
acaaataatatcaattcggatatagtaccatataatattgacttttcagaatataaactt
ttgattatgcctgcatttaatcttatgaaggatgatatattacaaagagttgaaaattat
gtatcgggagggggaaatttagtattaactttccgttcaggaactaaagaatggaataat
tcaatgacaattaaaacgctgccaggctatttcaaagaattagcaggagttacagttgaa
gaatttgattctataaattttggccgtgaagtacaaatgtttacagaatatggcatggga
aaagttttaatgtgggcagatattttaaaaccaataagcgctgaaataataggaacttat
gcaagtgatttttatgaaggtgaagctgcaataacggtaaactcttatggaaaaggtaaa
gtatattatattggatgtgatttggaacaggaagttctaaataaattattagaagaaata
gcattaaagtcaggaataaaacctttaatacctaataatattgaaggtgtagaagttgtt
tctaaggagaagaatggtagaaagtatattatagtaatgaatcataatggctatgaagtg
gaaattcatttaagcggtacatacaaagagcttattagcaatatagatatagatgggaaa
cttatgttaaatccatatgaggtggctatattagaaacaaatgtagggtaa

DBGET integrated database retrieval system