KEGG   Clostridium beijerinckii NCIMB 14988: LF65_02717Help
Entry
LF65_02717        CDS       T04773                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbei00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LF65_02717
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LF65_02717
Enzymes [BR:cbei01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LF65_02717
Peptidoglycan biosynthesis and degradation proteins [BR:cbei01011]
 Precursor biosynthesis
  Racemase
   LF65_02717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2983777..2984907
Genome map
AA seq 376 aa AA seqDB search
MGEYFRTYAKIDLEAILHNINEAKKRIEKNVKIMAIIKADGYGHGAAALGNFLKSEVDYY
GVATLEEALELRQAGIELPILILGYTSPSQYIEVVKNNITQTVHNTEMAKEMSKAGAICK
KEAKVHIALDTGMTRIGFDANEYGIAEVQEILTFSNLVVEGLFTHFATADEADKSYSKLQ
ISKYDKFVALLEERDINIPIKHMCNSAGIMEFDHHRFDMVRCGIITYGLYPSEEVNKNAI
TLKPALQWKTHVINVNIVDAGHGVSYGKTYITKNETKIATLSVGYADGYPRALSSKGRVL
IHGKYAPIIGRICMDQMMVDVTHIDNVRIEDEVTLVGKDGDNIIYVEELANIAGSFNYEF
VCGIGKRVQRVYKELA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatattttagaacttatgcaaaaatagatttagaggctattttgcataatata
aatgaagcaaaaaaacgaatagaaaaaaatgtgaagattatggcaataattaaggctgat
ggatatggacatggcgctgctgctctaggtaattttcttaaaagtgaagtggattattat
ggtgtagctactttagaggaagctctagagttacgtcaagctggaatagaattacctata
ttaattctcggatatacctcacctagtcaatatatagaagtagtcaaaaataatattacc
caaactgtgcataatactgaaatggctaaggaaatgtcaaaggcaggagcaatatgcaaa
aaagaagcaaaagttcatattgctctagatactggtatgactagaataggttttgatgca
aatgaatatggaatagcagaagttcaggagattttaactttttcaaatttagtagttgaa
ggtttgtttactcattttgctacagcagatgaagctgataaaagttatagtaaattgcaa
ataagcaaatatgataaatttgtagctttactagaagaaagagatataaatattcctatt
aagcatatgtgtaatagtgctggaattatggaatttgatcatcatcgctttgatatggtg
aggtgtggaataattacttatggattatatccatctgaagaagttaataaaaatgctatt
acattaaaaccagcgcttcaatggaaaacccatgtgataaatgtaaatatagttgatgca
ggtcatggagtaagttatgggaaaacatatattacaaaaaatgaaacaaagatagcaact
ctttctgtaggatatgctgatggatatcctagagctctttcttcaaagggaagagtattg
atacatggtaaatatgcaccaattataggaaggatttgcatggatcaaatgatggtggat
gttacacatatagataatgtgaggattgaagatgaagtaactttagttgggaaagatgga
gataatattatttatgttgaggaattagctaatatagctggaagctttaattatgagttt
gtctgcggtatagggaaaagagttcaaagagtttacaaagaattagcttaa

DBGET integrated database retrieval system