KEGG   Coxiella burnetii CbuG_Q212: CbuG_0037Help
Entry
CbuG_0037         CDS       T00787                                 

Definition
(GenBank) acyl-CoA synthetase
Organism
cbg  Coxiella burnetii CbuG_Q212
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
32971..35781
Genome map
AA seq 936 aa AA seqDB search
MDKSLTEIESQVISLTHQFLLESGAERAARAVSLDARLEHDLGIGSLEKAELFSRIEKSL
GVELPESLLVKAKQLNDVVKAVKMAEPTLLKVKREVIAPLKSTRTDPSKVETLVELLNLY
AQNEPDRPHIYFQNEFGEETIIRYGELYTGAKEFAQGLVGKGLKPSETVAIMLPTSADFF
YSFLGTLMAGGIPVPIYPPFRADQIEEYAKREAFILHNAGVRFLITFKRAAALSKLLQSF
VPSLLEVTTVKALTDISADLPTLDIEATDPVLIQYTSGSTGNPKGVLLNHANLLANISAY
GKTLNMQSTDAFVSWLPLYHDMGLIGAWMGSFYHGLPLTLLSPFTFLSRPEKWLWAIHYH
RGTISPGPNFAYDLCVKKIEDSDLEGLDLSSWRVALNGSEMIHPDTLRNFEKRFRKYGFK
KEAIFPAYGLAECALGLTFPPLNRGPNIDRIERLPYEKNNTAVPLTTRDKKYYEFVSCGS
VLEGHEIRIVDDNDNRVAERTIGNIQFKGPSAMQGYYRNSEATMAIYHNGWWATGDLGYL
AEGELFITGRKKDLIIRAGRNYHPTEIEAMASLAEGVRKGCVAAFGVADEKRGTEKLIIV
AETKEDKKIHPEIKKEIVDKVISQIGIPPDEILLVPPHTLPKTSSGKLRRSSCKQDYLAG
KLSRPSRSAFWQTIKLFIKSRAKKIEKWLINLIKVVFSFYVLILLFFTLLPVWLLVIILP
RKKAAAAFRFWARSIFRLIFSPISIKGKENISGQPMIYVANHGSFIDSVILAGVLPADTN
FIGKKELLKTPVIKSFVKQLDLVTVDRMDFSKSHSDVKRIEQTLEQGRSVLIFPEGTFSY
ATGVRPFKLGAFKIAAELGKPICPDAIVGARKILRANQFLVKPAKLEVIICKPLIPESKE
WEEVMRLRKQSRLLIAKYSGEHVLDLVSAGVLSESE
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatcattaacggaaatcgaatcgcaagttatttccctcacccatcaatttctg
ttggagtctggcgctgaacgcgccgcccgcgccgtttctctcgatgcacggttagagcac
gatttggggataggcagtctagaaaaagcagaattatttagccgcattgaaaaatcatta
ggtgtcgaattacccgaatctcttctcgtaaaagccaagcaattaaacgatgttgttaaa
gccgtaaaaatggctgaacccacgttgctcaaagtgaaaagggaagtcatcgcaccgctt
aaaagcactcgcaccgatccttctaaagtcgaaacgttagtcgaactcctcaacctctat
gctcaaaatgagcctgatcgtccgcacatttattttcaaaatgaattcggcgaagaaacc
attattcgttacggcgaactttatacgggagcaaaagaattcgcccagggtttagttgga
aaagggttaaaacccagtgaaaccgttgccattatgcttcccacgtcggccgattttttt
tattcatttttaggcacattgatggccggcggaatccctgttcctatttatccccccttt
cgtgctgatcaaattgaagaatatgccaagcgcgaagcctttatattgcataacgccggc
gttcgattcttaatcacattcaaacgcgccgctgcactaagtaaattacttcaatcgttt
gttcctagcctattagaagtgactaccgtcaaagcattaacggatatatcagcggattta
cccacattagatattgaagctacagatcctgtgttaatccaatatacctctgggagcacg
gggaatccaaaaggggtattgctgaatcatgctaatttattagcgaatataagcgcctat
ggaaaaacgctcaacatgcagtcaacggatgcgttcgtcagttggcttccgctttaccat
gatatgggtttgatcggcgcttggatgggaagcttttaccatgggttaccgttaacttta
ctttctcctttcacttttttatcccgtcctgaaaaatggttatgggcgattcattatcac
cgagggactatatctcccggtcctaatttcgcttacgacctgtgcgtaaaaaaaattgaa
gatagcgatcttgagggcttggatttaagttcttggcgagtagctctaaatggatcggaa
atgattcatcctgacaccttgcgtaattttgaaaaacgattcaggaaatatggatttaaa
aaagaagcgatttttcccgcttacggccttgcagaatgtgctttggggctcacttttcct
cctttaaatcgggggccgaatatcgatcgaatcgagcgattgccttatgaaaaaaacaat
accgccgtaccgttaaccacgcgcgataagaaatattatgaattcgtttcgtgcggcagt
gttttagaaggacacgaaatccgtattgtggacgataacgataatcgggttgctgaacgt
acgattggaaatatccagtttaaaggcccctccgccatgcaaggttattaccgtaactca
gaagcaacgatggcgatttatcataatggttggtgggcgacgggagaccttggatattta
gccgaaggagagctttttattactggtcggaagaaagatttaattattagggccggtcgt
aattatcatcccacagaaatcgaagcaatggctagcctcgctgagggagttcgaaaaggt
tgtgtggctgcttttggggtagctgatgaaaaaagagggacggaaaaattaataatagtc
gccgaaacgaaagaagataaaaaaattcatcctgaaataaaaaaagaaatagtagataaa
gtgatttcacaaatcggcatcccgcctgacgaaattttattagtacctccgcacaccttg
ccgaaaacatccagtggaaaattgcgtcgttcgagttgtaagcaagattatttggccgga
aaattaagtcgaccaagccggtctgctttttggcaaacgataaaattatttattaaaagt
cgtgcgaaaaaaatagaaaaatggttaattaatttgattaaagtggtatttagtttttat
gttctcattttattgtttttcaccttattacctgtttggttgttagtcattattctgcct
cgaaaaaaagcagccgccgcttttcggttttgggcgcgttcaatttttcggctcatattt
tctcccatttctattaaaggaaaagaaaatattagcggacaaccgatgatttatgtcgct
aatcatggcagttttatagatagcgtgatacttgctggtgtattgccggccgacaccaat
tttatcggtaaaaaagaattgttaaaaacacccgtcataaaaagcttcgtcaagcaactt
gacctcgtcacggttgatcgcatggatttttcaaaaagccattctgatgtgaaacgaatt
gagcagacattggaacaaggccgttccgtccttatttttcctgaagggacgtttagttat
gcaactggcgtacgaccatttaagctcggtgcttttaaaatcgcagccgaactagggaaa
cccatttgcccggatgctattgttggcgctagaaaaattttgcgcgcgaatcaattctta
gtaaaaccagcgaaattggaagtcattatttgtaaacccttaatccctgagagtaaggaa
tgggaggaggttatgcggttacgcaaacaatcccgccttttaattgcgaaatacagcggt
gagcacgttctagatttggtttcagcgggagtgctaagtgaatcagagtaa

DBGET integrated database retrieval system