KEGG   Clostridium botulinum H04402 065: H04402_03497Help
Entry
H04402_03497      CDS       T02076                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00473  D-Alanine metabolism
cbj01100  Metabolic pathways
cbj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    H04402_03497
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    H04402_03497
Enzymes [BR:cbj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     H04402_03497
Peptidoglycan biosynthesis and degradation proteins [BR:cbj01011]
 Precursor biosynthesis
  Racemase
   H04402_03497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CBZ05296
LinkDB All DBs
Position
complement(3668408..3669568)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDLDNLQHNLKQIKKICGNKEIIGVIKANAYGHGAMEIAPTLLENGVSR
LAVAVLSEAMELRMSGVKEPIMILGYTPWALGDMLLDNNIEQSVYSYNDALELSKIAVLK
RKILKIHIVVDTGMGRIGFLPTKESVEDVYKISKLPNIKIEGLFSHFSSADELDKDYTLY
QMNKYNEFINKLEEKNIQVPIKHIANSAAIIDLENTHLDAVRAGIIMYGYYPSNYVLRDN
INLKPVMSLKTSIVHIKKVSSGEYISYGRTFKTERESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTFIENLKVGDVVTIMGEENGVSYTAENIASQIGTISYE
VICNVNKRVPRVYKKDGKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaatcgatctagataatttacaacataac
ttaaaacaaataaaaaaaatatgtggaaataaagaaataataggggttataaaggctaat
gcatatggacatggagccatggaaatagcccctactcttttagaaaatggagtaagtaga
ttagcagtggcggttttaagtgaggctatggagcttagaatgagtggagtaaaggagccc
attatgatattaggttatacaccatgggctttaggagatatgcttttagataataatata
gaacaatctgtatactcttataatgatgctttagaattatctaaaatagcggtgctaaaa
agaaaaatattaaaaatacatatagtggtagatactggcatggggagaattgggttttta
cctacaaaagaaagtgtagaagatgtatataaaataagtaagttgcctaatattaaaata
gagggattattttcccatttttcttctgcggacgaattagataaagattatactttgtat
caaatgaataagtataatgaatttataaataaattagaagaaaaaaatattcaagtacct
ataaagcatattgctaatagcgcagctataattgatttagaaaatactcatttagatgca
gtaagagcaggtattataatgtatggatactatccgtccaattatgtactaagagataat
ataaatctgaagccagtaatgtctttaaaaactagtatagtacacataaaaaaagtatct
tcaggagaatatataagttatggcagaacattcaaaacagagagagaaagcataatagct
accttacctataggttatgcagatggatataatagattattaagcaacaaaggaaaagtt
atagttaacggcaaacttgctccagtaataggaagagtttgtatggatcaatgtatgata
gatgtaacttttatagaaaatttaaaagttggagatgtggttacaattatgggggaggaa
aatggagtaagctatactgcagagaatatagcatcacaaataggcaccataagttatgaa
gttatatgtaatgtaaataagagggtaccaagagtatataagaaggatggcaaaattata
aatgtagtaaattacatataa

DBGET integrated database retrieval system