KEGG   Clostridium botulinum F 230613: CBF_3565Help
Entry
CBF_3565          CDS       T01865                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00473  D-Alanine metabolism
cbm01100  Metabolic pathways
cbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBF_3565
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CBF_3565
Enzymes [BR:cbm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CBF_3565
Peptidoglycan biosynthesis and degradation proteins [BR:cbm01011]
 Precursor biosynthesis
  Racemase
   CBF_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADG01111
LinkDB All DBs
Position
complement(3740653..3741813)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDLDNLQHNLKQIKKICGNKEIIGVIKANAYGHGAMEVAPTLLENGVSR
LAVAVLSEAMELRMSGVKESIMILGYTPGALGDMLLDNDIEQSVYSYNDALELSKIAVLK
RKILKIHIVVDTGMGRIGFLPTKESVEDVYKISKLPNIKIEGLFSHFSSADELDKDYTLY
QMNKYNEFINKLEEKNIQVPIKHIANSAAIIDLENTHLDAVRAGIIMYGYYPSNYVLRDN
INLKPVMSLKTSIVHIKKVSSGEYISYGRTFKTERESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTFIENLKVGDVVTIMGEENGVSYTAEDIASQIGTISYE
VICNVNKRVPRVYKKDGKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaatcgatctagataatttacaacataac
ttaaaacaaataaaaaaaatatgtggaaataaagaaataataggggttataaaggctaat
gcatatggacatggagccatggaagtagcccctactcttttagaaaatggagtaagtaga
ttagcagtagcggttttaagtgaggctatggagcttagaatgagtggagtaaaggaatcc
attatgatattaggttatacaccaggggctttaggagatatgcttttagataatgatata
gagcaatctgtatactcttataatgatgccttagaattatctaaaatagcggtgctaaaa
agaaaaatattaaaaatacatatagtggtagatactggtatggggagaattgggttttta
cccacaaaagaaagtgtagaagatgtatataaaataagtaagttgcctaatattaaaata
gagggattattttcccatttttcttctgcggacgaattagacaaagattatactttgtat
caaatgaataagtataatgaatttataaataaattagaagaaaaaaatattcaagtacct
ataaagcatattgctaatagcgcagctataattgatttagaaaatactcatttagatgca
gtaagagcaggtattataatgtatggatactatccgtccaattatgtactaagagataat
ataaatctgaagccagtaatgtctttgaaaaccagtatagtacacataaaaaaagtgtct
tcaggagaatatataagttatggcagaactttcaaaacagagagagaaagcataatagct
accttacctataggttatgcagatggatataatagattattaagcaacaaaggaaaagtt
atagttaatggcaaacttgctccagtaataggaagagtttgtatggatcaatgtatgata
gatgtaacttttatagaaaatttaaaagttggagatgtggttacaattatgggggaggaa
aatggagtaagctatactgcagaggatatagcatcacaaataggcactataagttatgaa
gttatatgtaatgtaaataagagggtaccaagagtatataagaaggatggcaaaattata
aatgtagtaaattacatataa

DBGET integrated database retrieval system