KEGG   Clostridium botulinum BKT015925: CbC4_1943Help
Entry
CbC4_1943         CDS       T01475                                 

Definition
(GenBank) Mn/Fe superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cbn  Clostridium botulinum BKT015925
Brite
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CbC4_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEB76615
LinkDB All DBs
Position
2076399..2076986
Genome map
AA seq 195 aa AA seqDB search
MFNLPKLPYDYDSLEPYYDEETLKIHHDKHHQAYVDGLNKAESELINARNSGDYSLIKHW
EKELAFNGAGDVLHTLFWENMIPGGSTPSDNILEIINKDFGNFENFKKQFSSAAATVEGS
GWCALVFIPELDKLQIIQIEKHQNLVILGSIPLLVLDVWEHAYYLKYQNRRADFINAWWN
IVNWDEVTKRYLNMH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacttaccaaaactaccttatgattatgattctttagaaccttattatgatgaa
gaaacattaaaaattcatcatgataaacaccaccaagcctatgttgatggactaaataaa
gctgaatcagaacttattaatgctagaaattcaggagattattctcttataaagcattgg
gaaaaagaacttgcttttaatggagctggtgatgtacttcatactttattctgggaaaat
atgattcctggtggttctactccttctgataatatattagagataattaacaaagacttt
ggaaattttgaaaattttaaaaagcaattttcatctgcagcagctaccgtagaaggttct
ggttggtgtgctttagttttcattcctgaattagataaacttcaaataatacaaatcgaa
aaacatcaaaatctagtaatactaggaagtattcctcttttagtactagatgtatgggag
catgcttattatttaaaatatcaaaatagaagagcagactttataaatgcttggtggaat
atagtaaattgggatgaagtaactaaaagatatttaaatatgcactaa

DBGET integrated database retrieval system