KEGG   Caenorhabditis briggsae: CBG00491Help
Entry
CBG00491          CDS       T01054                                 

Gene name
Cbr-tufm-1
Definition
(RefSeq) C. briggsae CBR-TUFM-1 protein
  KO
K02358  elongation factor Tu
Organism
cbr  Caenorhabditis briggsae
Brite
Translation factors [BR:cbr03012]
 Eukaryotic Type
  Elongation factors
   CBG00491 (Cbr-tufm-1)
 Prokaryotic Type
   CBG00491 (Cbr-tufm-1)
Mitochondrial biogenesis [BR:cbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CBG00491 (Cbr-tufm-1)
Exosome [BR:cbr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBG00491 (Cbr-tufm-1)
  Exosomal proteins of breast cancer cells
   CBG00491 (Cbr-tufm-1)
  Exosomal proteins of colorectal cancer cells
   CBG00491 (Cbr-tufm-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 8582923
NCBI-ProteinID: XP_002640929
WormBase: CBG00491
LinkDB All DBs
Position
III
AA seq 496 aa AA seqDB search
MQIFSLLSRNVGAFKTVTLCEQKMQQVSLLQARHLAVPGGKAVFKRDKPHLNVGTIGHVD
HGKTTLTSAITKVLATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYETAKRHYAHIDC
PGHADYIKNMITGAAQMEGAILVVAATDGPMPQTKEHLLLARQVGVPLENIVVFMNKVDE
VPDAETRELVEMDIREQLNEFGYPGDTCPVIFGSALCALEGKQPEIGEEAVKQLLDVLDN
KFVIPERKVNEEPMFAAEHVYSIVGRGTVITGKLERGILKRGDKIEIVGGTKDGTTVKST
ISGLESFRKTVDQAEPGDQLGVLLRGLGPKDVRRGCVLLPQGHKHKVTDKVKAQLYVLKE
SEGGAKTPIANYFSEHVFSLTWDSGASVKIVGKDFVMPGESAEVELSLNSQMFIEPQQRF
TIRKGAKTIGTGVFTDVLPPLTNEEKDPKSKKKLMKAEMERLGFNPYGELAEKRLKPDFS
NSPKDNPAAKAFEGQP
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcagccttctcagccgaaatgtcggcgcttttaagactgtcacactttgc
gagcaaaaaatgcagcaagtgtcgcttcttcaggcccggcacctggcggttcccggcgga
aaagcggttttcaagagagacaaaccgcatttgaacgtcggaaccatcggacacgtcgat
cacggaaagacgacgttgacttcggcgattactaaggttcttgccacctccaaaggagcc
aaataccgtaaatacgaggatatcgacaacgctccagaagagaaggctcgtggtatcacc
atcaacgccttccacttggaatacgagaccgcgaaacgccattatgcccatattgactgc
cctggacacgcggattatatcaagaacatgatcacaggagccgcccagatggagggagcg
attctggtagttgcagctacagatggaccaatgccacagactaaggagcatcttttgttg
gccagacaagtcggcgtcccattggagaatattgtagtcttcatgaacaaagttgatgag
gttccagacgcggagacccgtgaattagtggaaatggatattcgagagcagctcaacgag
tttggataccctggagacacttgtccagtcatttttggctctgctctctgtgctcttgag
ggaaaacagccagagattggagaggaggctgttaagcagctccttgacgttcttgataac
aaattcgtgatcccagagagaaaagtgaatgaggaaccaatgttcgcagcggagcacgtt
tactcaatcgttggaagaggtactgtaatcactggaaagttggagagaggaattttgaag
agaggagataagattgagattgttggaggaactaaggatggcaccacagtgaaatccacc
atttctggattagaatcattcagaaagactgtggaccaagccgagccaggagatcagttg
ggagtgctccttagaggactgggaccaaaggatgtccgacgtggatgtgttcttttgcca
caaggacacaaacacaaggttactgataaggtcaaggctcagttgtatgtgttgaaggag
agcgagggaggagccaagacgccaattgccaactacttcagtgagcacgtcttctcgttg
acttgggattctggagcgagtgtgaagattgttggaaaggactttgtgatgcctggagag
tcggccgaagtggaactatcgctcaactcgcaaatgttcatcgagccccaacagagattc
accatccgtaaaggagcgaaaaccattggaacgggagtcttcaccgacgtccttccaccg
ctgaccaacgaggaaaaggacccgaaatcgaagaagaagttgatgaaggccgaaatggaa
cgattgggattcaatccgtacggagagctcgctgagaaacgtctgaaacctgacttctcc
aactcgccaaaggataatccggctgccaaggctttcgagggacaaccataa

DBGET integrated database retrieval system