KEGG   Caenorhabditis briggsae: CBG04290Help
Entry
CBG04290          CDS       T01054                                 

Definition
(RefSeq) Hypothetical protein CBG04290
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cbr  Caenorhabditis briggsae
Pathway
cbr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CBG04290
Enzymes [BR:cbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CBG04290
Chromosome and associated proteins [BR:cbr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CBG04290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 AdoMet_MTase Apt1
Motif
Other DBs
NCBI-GeneID: 8571873
NCBI-ProteinID: XP_002630358
WormBase: CBG04290
LinkDB All DBs
Position
II
AA seq 591 aa AA seqDB search
MNPPADETATGTSTPTSSSTPRRPGKRTAEEMALDLINNRPKVKRIVKLVSVFYEGKMLE
LDLNETTVPRGLIQWLRHLCSLIDEVTEGGFPKEWKVDDDPKNVLGPYTHDELVELVDMY
NLVAKPFAGAWAGSYNTGNLGDWGNPHCTSEIAGSIVQLAIEMGIPKVEDLNNCYRAWSS
ENHILELISMTPMRLSMPPMRHEVQSSTLVFSKINTTIGVLVLSDPYPEIYSPLAQIVVY
GETNLNQMASILDEVGVTNKDVFIDLGCGIGQLVFFTAAYAQCKKSYGIELNPFPYQLGA
NVQSIFTKLMKNFGKRFGKNEILEGDLMNVVFRAKISEATVIFINNLLFDAEFMWRLKTE
ILQYLDEGVKIITTKPLGDPKKINVTDRRIGDLSAISETVYLKSLQGGVSWTDKPCRFYL
TTINRMKLMNYFKQKRVMETEMSSKKKKPTKRNRSNDSATSSLDESTLSIPPTTDEPIQK
RHAGRPKLPKAIPDVLDADTPSKSRGRPKQISESSKSSSRRRSSDDEDYKPPSSSIRRKP
ARRSSVLQPKQEPLDYTEMPLLVKEEILDDVKNEDVSDVMERMLEQVVKMV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcccgccgacgaaaccgccaccggcacttcaacgccgacgtcgtcgtcaaca
ccgagaaggcccggaaaaaggacggccgaggaaatggcgctcgatttgattaacaatcgt
ccgaaagttaaaagaatcgtcaaattggtctccgtattttatgagggcaaaatgctggag
ctcgacttgaacgaaacgactgtgccaagaggattaattcagtggttgcggcacctatgt
agtcttatcgatgaagtgaccgagggaggattcccaaaggagtggaaggtcgacgatgat
ccaaaaaacgtgcttgggccttatacacacgatgaattagtcgagctggtcgacatgtat
aatctcgtcgccaaaccgttcgccggggcgtgggctggttcctacaacactggaaacctc
ggtgattggggaaatccacattgtacgtctgagattgctggaagtattgtccagcttgcg
atcgaaatgggcattccgaaagtggaggatctcaataattgctatcgtgcatggtcatcg
gagaatcatatactcgaattgatctcaatgacccctatgagactatcaatgccccctatg
agacatgaagtccagagttcaacgctggtattttctaaaatcaataccaccatcggagtt
ctcgtgctttctgacccctatcctgaaatttacagccctctagctcaaattgtcgtctat
ggagagacgaatctaaaccaaatggcgtcgattctcgatgaagtgggtgtaacaaataag
gacgtcttcatcgacctgggctgtggaattggacagctcgtgttcttcaccgccgcctat
gctcaatgcaaaaagagctatggaatcgagctgaatccattcccatatcagctgggtgcc
aacgtccaatcgattttcacaaagctcatgaagaatttcggcaaacgattcggaaagaac
gaaattctggagggtgatctgatgaacgtcgtgtttcgtgcgaagatcagtgaagcgacg
gtgatcttcatcaataatttgctgttcgatgctgaatttatgtggaggctgaagacggag
attcttcagtatctggatgaaggcgtcaagataatcactacgaaaccgctcggagatcca
aagaagatcaatgttacagacagacgtataggagatttatctgcgatatcggagacagtc
tacctgaaatcgttgcaaggtggtgtctcgtggacggacaaaccgtgtcgcttctacctg
acaacaatcaatcgaatgaagctcatgaactatttcaagcagaagagagtaatggagaca
gaaatgagctcgaaaaagaagaagccaacgaaacgtaatcgttcgaatgattccgcgacg
tcgtcactcgatgaatccacgttatcaattccacctactacggatgagccgattcagaag
cgccacgcgggacgtccaaagctgccaaaggcgattccagatgtgcttgatgctgataca
ccatccaaaagccgtggtcgtccaaagcagatttcggagtcatccaagtcatcgtcccgt
cgcagatcgtctgacgatgaggactacaaaccaccgtcttcttcgattcgtcgcaaaccg
gctcgtcgttcttcagttttgcagccaaagcaggagccattggactacaccgaaatgccg
cttctagtcaaagaagagattctagatgacgttaagaatgaggacgtcagcgatgtgatg
gaacgaatgctggagcaggtcgtcaagatggtctag

DBGET integrated database retrieval system