KEGG   Citrobacter braakii: A6J81_03230Help
Entry
A6J81_03230       CDS       T04825                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cbra  Citrobacter braakii
Pathway
cbra00250  Alanine, aspartate and glutamate metabolism
cbra00410  beta-Alanine metabolism
cbra00640  Propanoate metabolism
cbra00650  Butanoate metabolism
cbra01100  Metabolic pathways
cbra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A6J81_03230
   00650 Butanoate metabolism
    A6J81_03230
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6J81_03230
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A6J81_03230
Enzymes [BR:cbra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A6J81_03230
Amino acid related enzymes [BR:cbra01007]
 Aminotransferase (transaminase)
  Class III
   A6J81_03230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ARC39815
LinkDB All DBs
Position
635240..636502
Genome map
AA seq 420 aa AA seqDB search
MNNKNLQQRRLDATPRGVGVMCDFYAQSAENSTITDIEGNQYIDFAAGIAVLNTGHRHPR
LVQAVEAQLQAFTHTAYQIVPYESYVSLAEKINAVAPIDGKRKTTFFTTGAEAVENAVKI
ARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKKGFGPFPGSIYHAPYPSELQGISTA
DSIKAIERLFKADIDPTQVAAIIFEPVQGEGGFVVAPPEFVTAIRRICDEHGIVMIADEV
QSGFARTGQLFAMDHYADKADLMTMAKSLAGGMPLSGVVGKAEIMDAPAPGGLGGTYAGN
PLSIAAAHAVLDIIRDEQLCQRAAALGEQLRATLTEAQTGCPELAEVRGLGSMIAAEFCD
ATTGEPNAAAAQRVQKKALEQGLLLLTCGQYGNVIRFLYPLTIPQDQFAKALDIIKAATK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaaaacctgcaacaacgtcgtctggatgccaccccgcgtggcgtgggtgta
atgtgtgatttttatgcccagtcggcagaaaacagcacgattaccgatatcgaaggcaat
cagtacattgattttgccgccgggattgccgtgctgaacaccggacaccgtcatcctcgc
ctggtgcaggcagtcgaagcacagcttcaggcttttacccatactgcttatcagattgtc
ccgtatgaaagctatgtgtctttggctgagaaaatcaacgccgttgcgccaatcgacggt
aagcggaaaaccacgttcttcaccaccggggctgaagcggtagaaaacgcagtgaaaatc
gcccgcgcgcataccggccgtcctggcgttatcgcgtttggcggcggttttcatgggcgt
acttacatgacgatggcgttaaccggcaaagtagcgccctataaaaaaggattcggcccg
ttccctggctccatttaccatgcgccgtatccttctgaattgcaggggatttctacggca
gactccataaaagcgatcgagcgcctgtttaaagccgatatcgatccaacccaggttgcg
gcgattattttcgaacccgtccagggcgaaggaggcttcgtagtagcgccgccggaattt
gtgaccgccatccgccgtatttgcgacgagcatggcattgtgatgatcgctgatgaggtg
caaagcgggtttgcccgtacgggccagctgtttgcgatggatcattacgctgataaagcg
gatctgatgaccatggcaaaaagccttgcgggcggcatgccgctgtcaggcgtcgtgggc
aaagccgaaatcatggacgcgccagctccgggtggtctgggcggaacttacgccgggaac
ccgctgtcgattgcggcggctcatgcggtgctggatatcattcgtgatgaacagttgtgc
cagcgtgcggcggccctcggtgaacaactgcgcgccactctgaccgaggcgcaaacaggg
tgtcctgaactggccgaagtgcgtggcttaggctctatgattgccgctgaattctgtgat
gcaacgacgggagaacccaacgccgccgccgcacagcgcgtgcagaagaaagcccttgag
caaggattgctactgctgacctgtggtcaatatggcaacgttattcgtttcctttacccg
ctgaccattccgcaggatcagttcgccaaagcgcttgatatcatcaaagcggcaaccaaa
taa

DBGET integrated database retrieval system