KEGG   Citrobacter braakii: A6J81_18810Help
Entry
A6J81_18810       CDS       T04825                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbra  Citrobacter braakii
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbra00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A6J81_18810
Enzymes [BR:cbra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A6J81_18810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3871782..3873290)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPSS
TGLRFGADSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKHTWQARGLVNATGPWVKEFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLASYYQGIGPAWTKECILPGGDIGGDREDYAAKLRRRYPFLTESLARHYSRT
YGSNTEWIIGEATSLAELGEDFGHEFYEAELKYLVDHEWVRRAEDALWRRTKEGMWLNAE
QQSRMTQWLSEYIEKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggaggcatcaatggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaagcgcaggatttagcctgcgca
acctcctccgctagctccaaactcattcacggtggcctgcgctacctggaacattacgaa
tttcgcctggtgagcgaagcgctggccgaacgtgaagtgctgttgaaaatggcaccgcat
atcgcctttcctatgcgctttcgtctgccccatcgcccgcacctgcgcccggcctggatg
atccgcattggtctgtttatgtacgatcatctgggcaaacgcaccagtttgccgagttct
accggtttgcgttttggcgcagactccgtattgaaacctgagattgtgcgcggtttcgaa
tattctgactgctgggtagacgatgcgcgactggttttggcaaacgcccaaatggtcgta
cgcaaaggcggggaagtattaacccgcacgcgtgccacctccgctcgccgtgaaaacggt
ttgtggattgttgaagctgaagatatcgatactggcaaaaagcacacctggcaggcacgt
gggctggtcaacgccaccggcccgtgggtgaaagagttcttcgacgacggcatgcatctg
ccatcgccgtatggcattcgcctgattaaaggtagccacatcgtggttccgcgcgtacat
acccagaagcaggcttatattctgcaaaacgaagataaacgcattgtgtttgttatccca
tggatggacgaattctcgatcatcgggacgaccgacgttgaatacaaaggcgacccgaaa
gcggtgaaaattgatgagagcgaaatcaattacctgctgaaggtctacaacgcgcacttt
aagaaacagcttggccgtgacgatatcgtctggacatactcgggcgtacgtccgctgtgc
gatgacgaatccgactcgccgcaggctatcacccgtgattacacgctggatatccacgac
gaaaatggcaaagcgccgctgctgtcggtctttggcggtaagctgacgacctaccgtaag
ctggctgaacacgcgatggaaaaactggcgtcgtactatcagggcattggtccggcgtgg
acgaaagagtgcattctgccaggtggtgacattggcggcgatcgcgaagattacgcggcc
aaactgcgccgtcgctacccgttcctgaccgagtcgctggcacgccattattcccgcacc
tacggcagcaacaccgaatggattatcggcgaagccacctcgcttgccgagttaggtgaa
gacttcggccatgagttctatgaggccgagctgaaatatctggtcgatcacgaatgggtt
cgtcgtgcggaagatgcgctgtggcgtcgcacgaaagagggtatgtggctgaacgctgag
cagcagtcgcgcatgacccagtggttgtcggagtacattgagaagcaccagctgtcgctg
gcgtcgtaa

DBGET integrated database retrieval system