KEGG   Citrobacter braakii: A6J81_22935Help
Entry
A6J81_22935       CDS       T04825                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cbra  Citrobacter braakii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A6J81_22935
   00650 Butanoate metabolism
    A6J81_22935
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6J81_22935
   00280 Valine, leucine and isoleucine degradation
    A6J81_22935
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A6J81_22935
Enzymes [BR:cbra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A6J81_22935
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A6J81_22935
Amino acid related enzymes [BR:cbra01007]
 Aminotransferase (transaminase)
  Class III
   A6J81_22935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4726154..4727437)
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAVPRGVGQIHPIFAERAENCRVWDVEGREFLDFAGGIAVLNTGHLHP
QIVSAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRTGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCPLHGISD
DDAIASIHRIFKNDAAPEDVAAIVIEPVQGEGGFYAASPAFMQRLRAICDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAIPPGGLGGTYAG
NPIACAAALAVLNIFEQENLLQKANELGQTLREGLLAIAETHREIGDVRGLGAMIAIELF
EDGDRTKPDAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLDIIAQC
FAEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaacaaagaacttatgcaacgtcgcagcaacgccgttccccgtggcgttgga
cagatccacccaatttttgccgagcgggcagaaaactgtcgggtgtgggacgttgaaggc
cgtgaattcctcgattttgctggcggtatcgcggtgctgaacaccggccacctgcatccg
cagatcgtctctgcggtagaagcgcagttgaaaaagctgtcccatacctgtttccaggtg
ttggcttatgagccttaccttgagctgtgcgaaatcatgaacaagaaagtgccgggtgat
tttgccaagaaaaccctactggtaacgactggctccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccactaagcgaaccggcacgatcgctttcagcggcgcttaccacggt
cgtacgcactacaccctgtcgctgaccgggaaagtcaatccctactcagccggaatgggg
ctgatgccaggccacgtgtatcgcgcgctatatccgtgcccgctgcacggcatcagtgac
gacgatgctatcgccagcattcaccgcatcttcaaaaacgatgccgcgccggaagatgtt
gctgccatcgtgattgagcccgtccagggcgaaggtggtttctacgctgcctcacctgca
tttatgcaacgtctgcgcgccatttgtgacgagcacgggatcatgctgattgccgatgaa
gtacagagcggcgcgggccgtaccggtacgctgttcgctatggagcagatgggcgtcgcc
cccgatctcaccaccttcgccaaatccatcgccggcggcttcccgctggccggagtgacc
ggacgcgccgaagtgatggacgctatcccaccgggcgggctgggcggtacctatgccggt
aacccgattgcctgtgccgccgcgctggcggtactgaacattttcgaacaggaaaatctg
ctgcaaaaagccaacgagctgggacaaaccctgcgcgaaggcctgctggctatcgcggaa
acccaccgcgagattggcgatgtgcgcggactgggcgcgatgatcgctatcgaactgttt
gaagacggcgatcgcacgaagccagacgccaaactgactgcggaagtggtggcgcgtgca
cgcgataaagggctgatcctgctctcctgcggaccttactacaacgtgctgcgcattctg
gttccgctgaccattgaagacgcgcaaatccgccaggggctggacattatcgctcagtgt
tttgccgaggcgaagcagggttaa

DBGET integrated database retrieval system