KEGG   Coxiella burnetii RSA 331: COXBURSA331_A1132Help
Entry
COXBURSA331_A1132 CDS       T00632                                 

Definition
(GenBank) glutathione S-transferase family protein
Organism
cbs  Coxiella burnetii RSA 331
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C GST_N GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: ABX77745
LinkDB All DBs
Position
complement(1011386..1012060)
Genome map
AA seq 224 aa AA seqDB search
MSKETQNKQNFIILWGVSISPYVRKVMVALAEKGIAYEQKEILPKVLLEATGQKVPVEFN
QASPLGKIPTLQIGDYSLADSAVIAAYLDRKFSTGNQLYPRTPEAYAKARWFEQYSDTVL
TDIAYHKIFLERVIKPKVLNQAVDEKRIISATTQELPAVLDYLQNSLSKNLWLAGHEFSM
ADVAVATQFLALEMTGFEFPKDRWARLHEYFKQIISRASFKGIA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacccaaaacaagcaaaattttattattttatggggcgtatccatttca
ccttatgtcagaaaagtgatggtcgcgttagcagaaaagggaatcgcttacgagcagaaa
gaaatattaccgaaggtattactggaagcgaccgggcaaaaagtcccggttgaatttaac
caggcaagtccgttaggaaaaatacctactttacaaattggtgattattctcttgcagat
tcagcggtgattgctgcttatttggaccgtaagttttcaacgggcaatcaattgtacccc
agaacacctgaagcgtatgcaaaagcgcgctggttcgagcaatattcagataccgtttta
acagacattgcctatcacaaaatatttttagagcgtgtgataaaaccaaaagtacttaac
caagcagtcgatgaaaaacggataatttcggcaacgacccaagaattaccagctgtttta
gattatttgcaaaatagcctttcaaaaaatttatggctagcaggccatgagttttcaatg
gctgatgttgccgtagccacgcagtttctggcgctagaaatgacggggtttgagtttcct
aaagatcggtgggctagattgcatgagtattttaaacaaattatttccagagcctcgttt
aaaggaatagcttaa

DBGET integrated database retrieval system