KEGG   Clostridium botulinum E3: CLH_0978Help
Entry
CLH_0978          CDS       T00767                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, glpa
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbt  Clostridium botulinum E3
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLH_0978
Enzymes [BR:cbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CLH_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1021805..1023235
Genome map
AA seq 476 aa AA seqDB search
MYDVAIIGAGVIGASIFRELTKYNLKVAVLEKEKDVSMGTTKANSAIVHAGFDPKIGTLM
AKYNVKGNEMYEDLCKELDVPFKRNGSLVVAHSEEEMQTVKDLCKNGTEIGVRDLRVIDK
EELLKMEPNLTDEVHGALYAPTGGIVGPFEFTIALCENGVTNGGEIKLKKEVSSIKKENG
IFTIETTDGEKVEAKYIVNAAGLFADKVHNMICKETFSITPRTGEYYVMDKSQGKIVSHT
IFPCPSKMGKGILVSPTIHGNLIIGPDAIDIEDKTDLGTNGEGLDAIRESAMHTTTKINF
RESIRNFAGLRATPSTGDFIVEENAEVKGFVDAAGMKSPGLTSAPAVAEAVVEILGNAGL
ELTKKDNFIAKRHQIHFTELSAEEKAEMIKKNPQYGRMICRCESITEGEIVDSIKRSFGT
LSLDGVKRRCRPGMGRCQGGFCGPRVQEIIARECGVKLEEVVQEKDGSYILTGKTK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgtagcaataattggagctggtgtcattggagcttctatatttagagaatta
actaaatataacttaaaagtagctgttttagagaaagaaaaggacgtatcaatgggtact
acaaaagctaactcagcaatagtacatgctggatttgatccaaagataggtactttaatg
gctaagtacaacgtaaaaggaaatgaaatgtatgaagatctttgtaaagagttagacgtt
ccatttaaaagaaatggttcattagttgtagctcattcagaagaagaaatgcaaacagta
aaagatctttgtaaaaatggtactgaaataggtgttagagacctaagagttatagataaa
gaagaattgttaaaaatggaaccaaatcttacagatgaagttcatggagctttatatgca
ccaactggtggaatagtaggaccatttgaatttacaattgcattatgtgaaaacggtgta
actaatggtggagaaattaaacttaaaaaagaagtttcttcaatcaaaaaagaaaatgga
atctttacaatagagactactgatggagaaaaggtagaagctaaatatatagtaaatgct
gctggtcttttcgcagataaagtacacaatatgatttgtaaagaaacatttagtattact
ccaagaactggtgaatattatgtaatggataaatctcaaggtaaaatagtatctcataca
atattcccttgtccttctaaaatgggtaaaggtatattagttagtccaacaatacatggt
aatcttatcataggaccagatgctatagatattgaagataaaacagatttaggaacaaat
ggcgaaggattagacgctatcagagaatctgctatgcatactactacaaagattaatttc
agagaaagtataagaaactttgctggattaagagcaacaccaagtacaggagacttcata
gttgaagaaaatgctgaagttaaaggattcgttgatgctgctggtatgaaatcaccagga
ttaacttctgcaccagctgtagctgaagcagtagttgaaattttaggaaacgcaggtctt
gaattaactaagaaagataacttcatagctaagagacatcaaattcactttacagaatta
tcagctgaagaaaaagctgaaatgattaagaaaaacccacaatacggtagaatgatctgc
agatgtgaaagcattactgaaggtgaaatcgttgattctataaagagatcatttggaaca
ctttctctagatggtgttaagagaagatgtagaccaggaatgggaagatgccaaggtgga
ttctgtggaccaagagttcaagaaataatagcaagagaatgtggcgttaaattagaagaa
gtagtacaagaaaaagacggttcttacattttaacaggaaaaactaagtag

DBGET integrated database retrieval system