KEGG   Coxiella burnetii RSA 493: CBU_0819Help
Entry
CBU_0819          CDS       T00124                                 

Definition
(RefSeq) glutathione S-transferase
Organism
cbu  Coxiella burnetii RSA 493
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C GST_N GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 1208712
NCBI-ProteinID: NP_819839
UniProt: Q83DB9
LinkDB All DBs
Position
768703..769377
Genome map
AA seq 224 aa AA seqDB search
MSKETQNKQNFIILWGVSISPYVRKVMVALAEKGIAYEQKEILPKVLLEATGQKVPVEFN
QASPLGKIPTLQIGDYSLADSAVIAAYLDRKFSTGNQLYPRTPEAYAKARWFEQYSDTVL
TDIAYHKIFLERVIKPKVLNQAVDEKRIISATTQELPAVLDYLQNSLSKNLWLAGHEFSM
ADVAVATQFLALEMTGFEFPKDRWARLHEYFKQIISRASFKGIA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacccaaaacaagcaaaattttattattttatggggcgtatccatttca
ccttatgtcagaaaagtgatggtcgcgttagcagaaaagggaatcgcttacgagcagaaa
gaaatattaccgaaggtattactggaagcgaccgggcaaaaagtcccggttgaatttaac
caggcaagtccgttaggaaaaatacctactttacaaattggtgattattctcttgcagat
tcagcggtgattgctgcttatttggaccgtaagttttcaacgggcaatcaattgtacccc
agaacacctgaagcgtatgcaaaagcgcgctggttcgagcaatattcagataccgtttta
acagacattgcctatcacaaaatatttttagagcgtgtgataaaaccaaaagtacttaac
caagcagtcgatgaaaaacggataatttcggcaacgacccaagaattaccagctgtttta
gattatttgcaaaatagcctttcaaaaaatttatggctagcaggccatgagttttcaatg
gctgatgttgccgtagccacgcagtttctggcgctagaaatgacggggtttgagtttcct
aaagatcggtgggctagattgcatgagtattttaaacaaattatttccagagcctcgttt
aaaggaatagcttaa

DBGET integrated database retrieval system